• Gene id: 1592

Gene Summary

• Gene Symbol: CYP26A1   Gene   UCSC   Ensembl
• Aliases: CP26, CYP26, P450RAI, P450RAI1
• Gene name: cytochrome P450 family 26 subfamily A member 1
• Alternate names: cytochrome P450 26A1, P450, retinoic acid-inactivating, 1, cytochrome P450 retinoic acid-inactivating 1, cytochrome P450, family 26, subfamily A, polypeptide 1, cytochrome P450, subfamily XXVIA, polypeptide 1, cytochrome P450RAI, hP450RAI, retinoic acid 4-hydrox,
• Gene location: 10q23.33 (93073474: 93077884)     Exons: 8     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic r
• OMIM: 602239

Protein Summary

• Protein general information: O43174  
  • Name: Cytochrome P450 26A1 (EC 1.14.13. ) (Cytochrome P450 retinoic acid inactivating 1) (Cytochrome P450RAI) (hP450RAI) (Retinoic acid 4 hydroxylase) (Retinoic acid metabolizing cytochrome)
  • Length: 497  
  • Mass: 56199
  • Tissue specificity: Expressed in most fetal and adult tissues with highest levels in adult liver, heart, pituitary gland, adrenal gland, placenta and regions of the brain (PubMed
• Sequence:

  MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQMKRRKY
  GFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALE
  CYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLP
  IDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
  GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFR
  VALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKI
  LLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFTHFHGEI

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002403  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000224356
• Other Databases: GeneCards:  CYP26A1  Malacards:  CYP26A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0006696	ergosterol biosynthetic process	IBA	biological process
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0000249	C-22 sterol desaturase activity	IBA	molecular function
GO:0016125	sterol metabolic process	IBA	biological process
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0042573	retinoic acid metabolic process	IDA	biological process
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	molecular function
GO:0042573	retinoic acid metabolic process	IDA	biological process
GO:0062183	all-trans retinoic acid 18-hydroxylase activity	IDA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0019825	oxygen binding	TAS	molecular function
GO:0006766	vitamin metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0001822	kidney development	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0020037	heme binding	NAS	molecular function
GO:0034653	retinoic acid catabolic process	IDA	biological process
GO:0048387	negative regulation of retinoic acid receptor signaling pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00830	Retinol metabolism

Diseases

Associated diseases	References
Barrett's adenocarcinoma	PMID:18059332
Actinic keratosis	PMID:22179182
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)