• Gene id: 158809

Gene Summary

• Gene Symbol: MAGEB6   Gene   UCSC   Ensembl
• Aliases: CT3.4, MAGE-B6, MAGEB6A
• Gene name: MAGE family member B6
• Alternate names: melanoma-associated antigen B6, MAGE-B6 antigen, cancer/testis antigen 3.4, cancer/testis antigen family 3, member 4, melanoma antigen family B, 6, melanoma antigen family B6,
• Gene location: Xp21.3 (26192439: 26195645)     Exons: 2     NC_000023.11
• Gene summary(Entrez): This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
• OMIM: 603392

Protein Summary

• Protein general information: Q8N7X4  
  • Name: Melanoma associated antigen B6 (Cancer/testis antigen 3.4) (CT3.4) (MAGE B6 antigen)
  • Length: 407  
  • Mass: 43992
  • Tissue specificity: Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins. {ECO
• Sequence:

  MPRGHKSKLRTCEKRQETNGQPQGLTGPQATAEKQEESHSSSSSSRACLGDCRRSSDASIPQESQGVSPTGSPDA
  VVSYSKSDVAANGQDEKSPSTSRDASVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQG
  ASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKACTLAQFLQKKFEKKESILKADMLKCV
  RREYKPYFPQILNRTSQHLVVAFGVELKEMDSSGESYTLVSKLGLPSEGILSGDNALPKSGLLMSLLVVIFMNGN
  CATEEEVWEFLGLLGIYDGILHSIYGDARKIITEDLVQDKYVVYRQVCNSDPPCYEFLWGPRAYAETTKMRVLRV
  LADSSNTSPGLYPHLYEDALIDEVERALRLRA

• Structural information:
  • Protein Domains: (195..39-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR021072  IPR041898  IPR041899  IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000368320
• Other Databases: GeneCards:  MAGEB6  Malacards:  MAGEB6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881