Search Result
Gene id | 158798 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | AKAP14 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | AKAP28, PRKA14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | A-kinase anchoring protein 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | A-kinase anchor protein 14, A kinase (PRKA) anchor protein 14, A-kinase anchor protein 28 kDa, A-kinase anchoring protein 28, AKAP 28, AKAP-14, protein kinase A-anchoring protein 14, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
Xq24 (119895892: 119920715) Exons: 7 NC_000023.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 300462 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q86UN6 Name: A kinase anchor protein 14 (AKAP 14) (A kinase anchor protein 28 kDa) (AKAP 28) (Protein kinase A anchoring protein 14) (PRKA14) Length: 197 Mass: 22815 Tissue specificity: Present in cilia (at protein level). Expressed in tissues containing axoneme-based organelles (cilia and/or flagella) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIVEEERNPLKNIKWMTHGEFTV EKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMKVSKTKPPDAP IVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPFLFNRV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: AKAP14 Malacards: AKAP14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|