• Gene id: 158798

Gene Summary

• Gene Symbol: AKAP14   Gene   UCSC   Ensembl
• Aliases: AKAP28, PRKA14
• Gene name: A-kinase anchoring protein 14
• Alternate names: A-kinase anchor protein 14, A kinase (PRKA) anchor protein 14, A-kinase anchor protein 28 kDa, A-kinase anchoring protein 28, AKAP 28, AKAP-14, protein kinase A-anchoring protein 14,
• Gene location: Xq24 (119895892: 119920715)     Exons: 7     NC_000023.11
• Gene summary(Entrez): The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene
• OMIM: 300462

Protein Summary

• Protein general information: Q86UN6  
  • Name: A kinase anchor protein 14 (AKAP 14) (A kinase anchor protein 28 kDa) (AKAP 28) (Protein kinase A anchoring protein 14) (PRKA14)
  • Length: 197  
  • Mass: 22815
  • Tissue specificity: Present in cilia (at protein level). Expressed in tissues containing axoneme-based organelles (cilia and/or flagella)
• Sequence:

  MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIVEEERNPLKNIKWMTHGEFTV
  EKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMKVSKTKPPDAP
  IVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPFLFNRV

• Structural information:
  • Interpro: IPR025663  
  • STRING: ENSP00000360485
• Other Databases: GeneCards:  AKAP14  Malacards:  AKAP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005952	cAMP-dependent protein kinase complex	IBA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IBA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005952	cAMP-dependent protein kinase complex	IMP	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)