• Gene id: 158747

Gene Summary

• Gene Symbol: MOSPD2   Gene   UCSC   Ensembl
• Gene name: motile sperm domain containing 2
• Alternate names: motile sperm domain-containing protein 2,
• Gene location: Xp22.2 (14873420: 14922326)     Exons: 16     NC_000023.11

Protein Summary

• Protein general information: Q8NHP6  
  • Name: Motile sperm domain containing protein 2
  • Length: 518  
  • Mass: 59746
  • Tissue specificity: Highly expressed in CD14(+) monocytes, and at lower levels in neutrophils. Does not show significant expression in B-cells or T-cells. {ECO
• Sequence:

  MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDESFQWRKEI
  SVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQKTILDKKKLIAFWLERYAKRENGKPVTVMFD
  LSETGINSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVE
  YLPPHMGGTDPFKYSYPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
  SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVK
  PSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELTQFWKEVPRNKVMEHRLRCHTVESSKP
  NTLTLKDNAFNMSDKTSEDICLQLSRLLESNRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS

• Structural information:
  • Protein Domains: (82..23-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056-)
    (327..44-)
    (/note="MSP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00132"-)
  • Interpro: IPR001251  IPR036865  IPR036273  IPR013783  IPR000535   IPR008962  
  • Prosite: PS50191 PS50202
  • CDD: cd00170
  • STRING: ENSP00000369860
• Other Databases: GeneCards:  MOSPD2  Malacards:  MOSPD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0140284	endoplasmic reticulum-endosome membrane contact site	IDA	cellular component
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IDA	biological process
GO:0044232	organelle membrane contact site	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881