• Gene id: 158511

Gene Summary

• Gene Symbol: CSAG1   Gene   UCSC   Ensembl
• Aliases: CSAGE, CT24.1
• Gene name: chondrosarcoma associated gene 1
• Alternate names: putative chondrosarcoma-associated gene 1 protein, cancer/testis antigen 24.1, cancer/testis antigen CSAGE, cancer/testis antigen family 24, member 1,
• Gene location: Xq28 (152733720: 152727483)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same prote
• OMIM: 611765

Protein Summary

• Protein general information: Q6PB30  
  • Name: Putative chondrosarcoma associated gene 1 protein (Cancer/testis antigen 24.1) (CT24.1) (Cancer/testis antigen CSAGE)
  • Length: 78  
  • Mass: 8697
  • Tissue specificity: Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues. {ECO
• Sequence:

  MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTK
  GSP

• Structural information:
  • STRING: ENSP00000359310
• Other Databases: GeneCards:  CSAG1  Malacards:  CSAG1

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881