• Gene id: 1579

Gene Summary

• Gene Symbol: CYP4A11   Gene   UCSC   Ensembl
• Aliases: CP4Y, CYP4A2, CYP4AII, CYPIVA11
• Gene name: cytochrome P450 family 4 subfamily A member 11
• Alternate names: cytochrome P450 4A11, 20-HETE synthase, 20-hydroxyeicosatetraenoic acid synthase, P450HL-omega, alkane-1 monooxygenase, cytochrome P-450HK-omega, cytochrome P450, family 4, subfamily A, polypeptide 11, cytochrome P450, subfamily IVA, polypeptide 11, cytochrome P4,
• Gene location: 1p33 (46941475: 46929176)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 601310

Protein Summary

• Protein general information: Q02928  
  • Name: Cytochrome P450 4A11 (EC 1.14.14.1) (20 hydroxyeicosatetraenoic acid synthase) (20 HETE synthase) (CYP4AII) (CYPIVA11) (Cytochrome P 450HK omega) (Cytochrome P450HL omega) (Fatty acid omega hydroxylase) (Lauric acid omega hydroxylase) (Long chain fatty ac
  • Length: 519  
  • Mass: 59348
  • Tissue specificity: Expressed in liver (PubMed
• Sequence:

  MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI
  QKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF
  HYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLN
  NLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
  ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMC
  IKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPF
  SGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000311095
• Other Databases: GeneCards:  CYP4A11  Malacards:  CYP4A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001822	kidney development	IBA	biological process
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0043651	linoleic acid metabolic process	IBA	biological process
GO:0048252	lauric acid metabolic process	IBA	biological process
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0018685	alkane 1-monooxygenase activity	IBA	molecular function
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0046456	icosanoid biosynthetic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0018685	alkane 1-monooxygenase activity	TAS	molecular function
GO:0006631	fatty acid metabolic process	TAS	biological process
GO:0070330	aromatase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	TAS	biological process
GO:0097267	omega-hydroxylase P450 pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0018685	alkane 1-monooxygenase activity	IDA	molecular function
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0036101	leukotriene B4 catabolic process	IEA	biological process
GO:0031408	oxylipin biosynthetic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0050051	leukotriene-B4 20-monooxygenase activity	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0006691	leukotriene metabolic process	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0032305	positive regulation of icosanoid secretion	IMP	biological process
GO:0055078	sodium ion homeostasis	IEP	biological process
GO:0003095	pressure natriuresis	IEP	biological process
GO:0003091	renal water homeostasis	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04270	Vascular smooth muscle contraction
hsa04750	Inflammatory mediator regulation of TRP channels
hsa03320	PPAR signaling pathway
hsa00830	Retinol metabolism
hsa00590	Arachidonic acid metabolism
hsa00071	Fatty acid degradation

Diseases

Associated diseases	References
Hypertension	PMID:16144986
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq