• Gene id: 157753

Gene Summary

• Gene Symbol: TMEM74   Gene   UCSC   Ensembl
• Aliases: NET36
• Gene name: transmembrane protein 74
• Alternate names: transmembrane protein 74,
• Gene location: 8q23.1 (27576521: 27582721)     Exons: 1     NC_000002.12
• OMIM: 613935

Protein Summary

• Protein general information: Q96NL1  
  • Name: Transmembrane protein 74
  • Length: 305  
  • Mass: 33338
  • Tissue specificity: Expressed in heart, lung, and placenta. {ECO
• Sequence:

  MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNST
  LQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQE
  AAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESARLG
  AHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNENTLELSLVEEDA
  LAVQS

• Structural information:
  • Interpro: IPR029696  IPR029695  
  • STRING: ENSP00000297459
• Other Databases: GeneCards:  TMEM74  Malacards:  TMEM74

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006914	autophagy	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016236	macroautophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq