• Gene id: 1577

Gene Summary

• Gene Symbol: CYP3A5   Gene   UCSC   Ensembl
• Aliases: CP35, CYPIIIA5, P450PCN3, PCN3
• Gene name: cytochrome P450 family 3 subfamily A member 5
• Alternate names: cytochrome P450 3A5, aryl hydrocarbon hydroxylase, cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, cytochrome P450-PCN3, flavoprotein-linked monooxygenase, microso,
• Gene location: 7q22.1 (99679995: 99648193)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protei
• OMIM: 605325

Protein Summary

• Protein general information: P20815  
  • Name: Cytochrome P450 3A5 (EC 1.14.14.1) (CYPIIIA5) (Cytochrome P450 PCN3)
  • Length: 502  
  • Mass: 57109
• Sequence:

  MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTY
  EGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIA
  QYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIIL
  FPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
  IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLER
  TCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMN
  MKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLSGE

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR008072  IPR002402  IPR036396  
  • Prosite: PS00086
  • PDB: 5VEU
  • PDBsum: 5VEU
  • STRING: ENSP00000222982
• Other Databases: GeneCards:  CYP3A5  Malacards:  CYP3A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0101020	estrogen 16-alpha-hydroxylase activity	IBA	molecular function
GO:0008202	steroid metabolic process	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0050649	testosterone 6-beta-hydroxylase activity	IBA	molecular function
GO:0070989	oxidative demethylation	IBA	biological process
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0042573	retinoic acid metabolic process	IDA	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0019825	oxygen binding	TAS	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0070330	aromatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0101020	estrogen 16-alpha-hydroxylase activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0009822	alkaloid catabolic process	IDA	biological process
GO:0042737	drug catabolic process	IDA	biological process
GO:0070989	oxidative demethylation	IDA	biological process
GO:0008202	steroid metabolic process	IDA	biological process
GO:0002933	lipid hydroxylation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0004497	monooxygenase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis

Diseases

Associated diseases	References
chronic myeloid leukemia	PMID:19584153
chronic myeloid leukemia	PMID:21039054
acute lymphocytic leukemia	PMID:19650988
acute lymphocytic leukemia	PMID:22215203
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)