• Gene id: 157506

Gene Summary

• Gene Symbol: RDH10   Gene   UCSC   Ensembl
• Aliases: SDR16C4
• Gene name: retinol dehydrogenase 10
• Alternate names: retinol dehydrogenase 10, retinol dehydrogenase 10 (all-trans), short chain dehydrogenase/reductase family 16C member 4,
• Gene location: 8q21.11 (73294601: 73325280)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for l
• OMIM: 615713

Protein Summary

• Protein general information: Q8IZV5  
  • Name: Retinol dehydrogenase 10 (EC 1.1.1.300) (Short chain dehydrogenase/reductase family 16C member 4)
  • Length: 341  
  • Mass: 38087
  • Tissue specificity: Detected in retina, kidney, liver, small intestine, placenta, lung, heart and skeletal muscle. {ECO
• Sequence:

  MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEE
  TAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVS
  GHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLS
  HELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
  SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI

• Structural information:
  • Interpro: IPR036291  IPR032970  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000240285
• Other Databases: GeneCards:  RDH10  Malacards:  RDH10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005811	lipid droplet	IBA	cellular component
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA	molecular function
GO:0002138	retinoic acid biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0052650	NADP-retinol dehydrogenase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0052650	NADP-retinol dehydrogenase activity	IEA	molecular function
GO:0007601	visual perception	IDA	biological process
GO:0004745	retinol dehydrogenase activity	IDA	molecular function
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0001656	metanephros development	IEA	biological process
GO:0004745	retinol dehydrogenase activity	IEA	molecular function
GO:0008406	gonad development	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0014032	neural crest cell development	IEA	biological process
GO:0043584	nose development	IEA	biological process
GO:0048703	embryonic viscerocranium morphogenesis	IEA	biological process
GO:0060449	bud elongation involved in lung branching	IEA	biological process
GO:1900054	positive regulation of retinoic acid biosynthetic process	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0002138	retinoic acid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031076	embryonic camera-type eye development	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0043583	ear development	IEA	biological process
GO:0048568	embryonic organ development	IEA	biological process
GO:0060431	primary lung bud formation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0042574	retinal metabolic process	IDA	biological process
GO:0042572	retinol metabolic process	IDA	biological process
GO:0004745	retinol dehydrogenase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00830	Retinol metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881