• Gene id: 157378

Gene Summary

• Gene Symbol: TMEM65   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 65
• Alternate names: transmembrane protein 65,
• Gene location: 8q24.13 (124372698: 124310917)     Exons: 7     NC_000008.11
• OMIM: 607555

Protein Summary

• Protein general information: Q6PI78  
  • Name: Transmembrane protein 65
  • Length: 240  
  • Mass: 25498
  • Tissue specificity: Predominantly expressed the ventricular tissue (at protein level). {ECO
• Sequence:

  MSRLLPLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQGARDF
  IYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAGTHIEMSIGII
  LGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKAVGVTIGCILGMFPLI
  FFGGGEEDEKLETKS

• Structural information:
  • Interpro: IPR019537  
  • STRING: ENSP00000297632
• Other Databases: GeneCards:  TMEM65  Malacards:  TMEM65

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0014704	intercalated disc	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1903779	regulation of cardiac conduction	ISS	biological process
GO:0003231	cardiac ventricle development	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903779	regulation of cardiac conduction	IEA	biological process
GO:0014704	intercalated disc	IEA	cellular component
GO:0003231	cardiac ventricle development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881