• Gene id: 1573

Gene Summary

• Gene Symbol: CYP2J2   Gene   UCSC   Ensembl
• Aliases: CPJ2, CYPIIJ2
• Gene name: cytochrome P450 family 2 subfamily J member 2
• Alternate names: cytochrome P450 2J2, albendazole monooxygenase (hydroxylating), albendazole monooxygenase (sulfoxide-forming), arachidonic acid epoxygenase, cytochrome P450, family 2, subfamily J, polypeptide 2, cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) po,
• Gene location: 1p32.1 (59926797: 59893307)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 601258

SNPs

rs17088625

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.22790337T>C
NC_000008.10   g.22647850T>C|SEQ=[T/C]|GENE=PEBP4

Protein Summary

• Protein general information: P51589  
  • Name: Cytochrome P450 2J2 (EC 1.14.14. ) (Albendazole monooxygenase (hydroxylating)) (EC 1.14.14.74) (Albendazole monooxygenase (sulfoxide forming)) (EC 1.14.14.73) (Arachidonic acid epoxygenase) (CYPIIJ2) (Hydroperoxy icosatetraenoate isomerase) (EC 5.4.4.7)
  • Length: 502  
  • Mass: 57611
  • Tissue specificity: Highly expressed in heart, present at lower levels in liver, kidney and skeletal muscle (at protein level). {ECO
• Sequence:

  MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQLFVKKY
  GNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGL
  GKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASK
  TCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
  LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNI
  IPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLG
  EQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCAVPQV

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR008071  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000360247
• Other Databases: GeneCards:  CYP2J2  Malacards:  CYP2J2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0020037	heme binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0006690	icosanoid metabolic process	IDA	biological process
GO:0016853	isomerase activity	IDA	molecular function
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0006690	icosanoid metabolic process	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0106255	hydroperoxy icosatetraenoate isomerase activity	IEA	molecular function
GO:0019373	epoxygenase P450 pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0008404	arachidonic acid 14,15-epoxygenase activity	IDA	molecular function
GO:0008405	arachidonic acid 11,12-epoxygenase activity	IDA	molecular function
GO:0071614	linoleic acid epoxygenase activity	IDA	molecular function
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04726	Serotonergic synapse
hsa04750	Inflammatory mediator regulation of TRP channels
hsa00590	Arachidonic acid metabolism
hsa04913	Ovarian steroidogenesis
hsa00591	Linoleic acid metabolism

Diseases

Associated diseases	References
Renal fibrosis	PMID:22260463
Pre-eclampsia	PMID:23155181
Renal hypertension	PMID:20495177
Hypertension	PMID:17286575
Myocardial infarction	PMID:17126841
Pulmonary hypertension	PMID:20118222
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray