• Gene id: 157285

Gene Summary

• Gene Symbol: PRAG1   Gene   UCSC   Ensembl
• Aliases: NACK, PEAK2, PRAGMIN, SGK223
• Gene name: PEAK1 related, kinase-activating pseudokinase 1
• Alternate names: inactive tyrosine-protein kinase PRAG1, PEAK family member 2, Pragmin, RND2 effector protein, homolog of rat pragma of Rnd2, sugen kinase 223, tyrosine-protein kinase PRAG1, tyrosine-protein kinase SgK223,
• Gene location: 8p23.1 (8386438: 8317735)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene encodes an enzyme that belongs to the tyrosine protein kinase family. A similar protein in rat binds to Rho family GTPase 2 (Rnd2) and regulates neurite outgrowth via activation of Ras homolog gene family, member A (RhoA). [provided by RefSeq, M

Protein Summary

• Protein general information: Q86YV5  
  • Name: Inactive tyrosine protein kinase PRAG1 (PEAK1 related kinase activating pseudokinase 1) (Pragmin) (Sugen kinase 223) (SgK223)
  • Length: 1406  
  • Mass: 149624
• Sequence:

  MHQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVN
  SSPYSKPTIAVKPTMMSSEASDVWTEANLSAEVSQVIWRRAPGKLPLPKQEDAPVVYLGSFRGVQKPAGPSTSPD
  GNSRCPPAYTMVGLHNLEPRGERNIAFHPVSFPEEKAVHKEKPSFPYQDRPSTQESFRQKLAAFAGTTSGCHQGP
  GPLRESLPSEDDSDQRCSPSGDSEGGEYCSILDCCPGSPVAKAASQTAGSRGRHGGRDCSPTCWEQGKCSGPAEQ
  EKRGPSFPKECCSQGPTAHPSCLGPKKLSLTSEAAISSDGLSCGSGSGSGSGASSPFVPHLESDYCSLMKEPAPE
  KQQDPGCPGVTPSRCLGLTGEPQPPAHPREATQPEPIYAESTKRKKAAPVPSKSQAKIEHAAAAQGQGQVCTGNA
  WAQKAASGWGRDSPDPTPQVSATITVMAAHPEEDHRTIYLSSPDSAVGVQWPRGPVSQNSEVGEEETSAGQGLSS
  RESHAHSASESKPKERPAIPPKLSKSSPVGSPVSPSAGGPPVSPLADLSDGSSGGSSIGPQPPSQGPADPAPSCR
  TNGVAISDPSRCPQPAASSASEQRRPRFQAGTWSRQCRIEEEEEVEQELLSHSWGRETKNGPTDHSNSTTWHRLH
  PTDGSSGQNSKVGTGMSKSASFAFEFPKDRSGIETFSPPPPPPKSRHLLKMNKSSSDLEKVSQGSAESLSPSFRG
  VHVSFTTGSTDSLASDSRTCSDGGPSSELAHSPTNSGKKLFAPVPFPSGSTEDVSPSGPQQPPPLPQKKIVSRAA
  SSPDGFFWTQGSPKPGTASPKLNLSHSETNVHDESHFSYSLSPGNRHHPVFSSSDPLEKAFKGSGHWLPAAGLAG
  NRGGCGSPGLQCKGAPSASSSQLSVSSQASTGSTQLQLHGLLSNISSKEGTYAKLGGLYTQSLARLVAKCEDLFM
  GGQKKELHFNENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGSTYAVKICKAPEPKTVSYCSPSVPVHFNIQQD
  CGHFVASVPSSMLSSPDAPKDPVPALPTHPPAQEQDCVVVITREVPHQTASDFVRDSAASHQAEPEAYERRVCFL
  LLQLCNGLEHLKEHGIIHRDLCLENLLLVHCTLQAGPGPAPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAAGPAS
  PEGPREKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTGILIYELLHQPNPFEVRA
  QLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKRVLQCLLWGPRRELVQQPGTSEEALCGT
  LHNWIDMKRALMMMKFAEKAVDRRRGVELEDWLCCQYLASAEPGALLQSLKLLQLL

• Structural information:
  • Protein Domains: (978..132-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008266  
  • Prosite: PS50011 PS00109
  • PDB: 5VE6
  • PDBsum: 5VE6
  • STRING: ENSP00000481109
• Other Databases: GeneCards:  PRAG1  Malacards:  PRAG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	IBA	molecular function
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0016477	cell migration	IMP	biological process
GO:2000145	regulation of cell motility	ISS	biological process
GO:0008360	regulation of cell shape	ISS	biological process
GO:0005524	ATP binding	ISS	NOT|molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0008593	regulation of Notch signaling pathway	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2000145	regulation of cell motility	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray