• Gene id: 1571

Gene Summary

• Gene Symbol: CYP2E1   Gene   UCSC   Ensembl
• Aliases: CPE1, CYP2E, P450-J, P450C2E
• Gene name: cytochrome P450 family 2 subfamily E member 1
• Alternate names: cytochrome P450 2E1, 4-nitrophenol 2-hydroxylase, CYPIIE1, cytochrome P450, family 2, subfamily E, polypeptide 1, cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1, cytochrome P450-J, flavoprotein-linked monooxygenase, microsomal monooxygenase, xe,
• Gene location: 10q26.3 (133527362: 133539122)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 617779

Protein Summary

• Protein general information: P05181  
  • Name: Cytochrome P450 2E1 (EC 1.14.14.1) (4 nitrophenol 2 hydroxylase) (EC 1.14.13.n7) (CYPIIE1) (Cytochrome P450 J)
  • Length: 493  
  • Mass: 56849
• Sequence:

  MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQ
  RMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQRE
  AHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFL
  HYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
  TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRD
  TIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
  LCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR008070  IPR036396  
  • Prosite: PS00086
  • PDB: 3E4E 3E6I 3GPH 3KOH 3LC4 3T3Z
  • PDBsum: 3E4E 3E6I 3GPH 3KOH 3LC4 3T3Z
  • STRING: ENSP00000440689
• Other Databases: GeneCards:  CYP2E1  Malacards:  CYP2E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0020037	heme binding	IBA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0008392	arachidonic acid epoxygenase activity	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0019373	epoxygenase P450 pathway	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0018601	4-nitrophenol 2-monooxygenase activity	IDA	molecular function
GO:0004497	monooxygenase activity	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0018960	4-nitrophenol metabolic process	IDA	biological process
GO:0002933	lipid hydroxylation	IDA	biological process
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	TAS	molecular function
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0051879	Hsp90 protein binding	ISS	molecular function
GO:0030544	Hsp70 protein binding	ISS	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0019825	oxygen binding	TAS	molecular function
GO:0070330	aromatase activity	IEA	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0017144	drug metabolic process	TAS	biological process
GO:0018885	carbon tetrachloride metabolic process	TAS	biological process
GO:0018910	benzene metabolic process	TAS	biological process
GO:0042197	halogenated hydrocarbon metabolic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006805	xenobiotic metabolic process	IEA	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0031227	intrinsic component of endoplasmic reticulum membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0009617	response to bacterium	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0051879	Hsp90 protein binding	IEA	molecular function
GO:0004497	monooxygenase activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0017144	drug metabolic process	IDA	biological process
GO:0046483	heterocycle metabolic process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0017144	drug metabolic process	IMP	biological process
GO:0016098	monoterpenoid metabolic process	IDA	biological process
GO:0008202	steroid metabolic process	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04932	Non-alcoholic fatty liver disease
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00590	Arachidonic acid metabolism
hsa00140	Steroid hormone biosynthesis
hsa00591	Linoleic acid metabolism

Diseases

Associated diseases	References
oral squamous cell carcinoma	PMID:22954124
Stomach cancer	PMID:22957075
morbid obesity	PMID:12883487
acoustic neuroma	PMID:12540498
Asthma	PMID:20514434
Malignant glioma	PMID:12540498
Chronic obstructive pulmonary disease	PMID:17442289
Liver disease	PMID:20392357
hepatocellular carcinoma	PMID:20364586
oral cavity cancer	PMID:16721740
colorectal cancer	PMID:30489355
nasopharynx carcinoma	PMID:26582733
type 2 diabetes mellitus	PMID:12534643
Fatty liver disease	PMID:14606109
type 1 diabetes mellitus	PMID:12743671
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray