• Gene id: 157

Gene Summary

• Gene Symbol: GRK3   Gene   UCSC   Ensembl
• Aliases: ADRBK2, BARK2
• Gene name: G protein-coupled receptor kinase 3
• Alternate names: beta-adrenergic receptor kinase 2, adrenergic, beta, receptor kinase 2, beta-ARK-2,
• Gene location: 22q12.1 (25564674: 25729293)     Exons: 23     NC_000022.11
• Gene summary(Entrez): The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic rec
• OMIM: 0

SNPs

rs17088625

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.22790337T>C
NC_000008.10   g.22647850T>C|SEQ=[T/C]|GENE=PEBP4

rs2287498

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7689242C>T
NC_000017.10   g.7592560C>T
NG_017013.2   g.3309G>A
NG_028245.1   g.8172C>T
NM_018081.2   c.450C>T
NM_001143991.2   c.450C>T
NM_001143991.1   c.450C>T
NM_001143992.2   c.450C>T
NM_001143992.1   c.450C>T
NM_001143990.1   c.450C>T
XR_001752551.  

rs1042522

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7676154G>A
NC_000017.11   g.7676154G>C
NC_000017.11   g.7676154G>T
NC_000017.10   g.7579472G>A
NC_000017.10   g.7579472G>C
NC_000017.10   g.7579472G>T
NG_017013.2   g.16397C>T
NG_017013.2   g.16397C>G
NG_017013.2   g.16397C>A
NM_000546.6   c.215C>T
NM_0  

Protein Summary

• Protein general information: P35626  
  • Name: Beta adrenergic receptor kinase 2 (Beta ARK 2) (EC 2.7.11.15) (G protein coupled receptor kinase 3)
  • Length: 688  
  • Mass: 79710
• Sequence:

  MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNE
  INEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYI
  EEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKK
  RIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
  IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWF
  SLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPELKSLLEGLLQRDVSKRLGCHGGGSQEVKEH
  SFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETV
  YEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
  LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVEL
  PKPSLCHRNSNGL

• Structural information:
  • Protein Domains: (54..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (191..45-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (454..52-)
    (/note="AGC-kinase-C-terminal)
    (558..65-)
    (/note="PH-)
    (/-)
  • Interpro: IPR000961  IPR000239  IPR011009  IPR011993  IPR001849   IPR000719  IPR017441  IPR016137  IPR036305  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108 PS50132
  • STRING: ENSP00000317578
• Other Databases: GeneCards:  GRK3  Malacards:  GRK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0047696	beta-adrenergic receptor kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0047696	beta-adrenergic receptor kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0031623	receptor internalization	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa04740	Olfactory transduction
hsa04724	Glutamatergic synapse
hsa05032	Morphine addiction
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Bipolar disorder	PMID:19400979
congestive heart failure	PMID:22685168
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq