• Gene id: 1564

Gene Summary

• Gene Symbol: CYP2D7   Gene   UCSC   Ensembl
• Aliases: CYP2D, CYP2D6, CYP2D7AP, CYP2D7P, CYP2D7P1, CYP2D@, P450C2D, P450DB1, RNA40057
• Gene name: cytochrome P450 family 2 subfamily D member 7 (gene/pseudogene)
• Alternate names: putative cytochrome P450 2D7, Putative cytochrome P450 2D7, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 1, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 1, cytochrome P450, subfamil,
• Gene location: 22q13.2 (42144482: 42139575)     Exons: 9     NC_000022.11
• Gene summary(Entrez): This gene is a member of the cytochrome P450 gene superfamily. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is a segregating ps
• OMIM: 601207

Protein Summary

• Protein general information: A0A087X1C5  
  • Name: Putative cytochrome P450 2D7 (EC 1.14.14.1)
  • Length: 515  
  • Mass: 57489
  • Tissue specificity: Expressed in brain cortex (at protein level). {ECO
• Sequence:

  MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAW
  TPVVVLNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVILSRYGPAWREQRRFSVSTLRNLGLGKKSLE
  QWVTEEAACLCAAFADQAGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLN
  AVPVLPHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKEKAKGSPESSFNDENLRIVVG
  NLFLAGMVTTSTTLAWGLLLMILHLDVQRGRRVSPGCPIVGTHVCPVRVQQEIDDVIGQVRRPEMGDQAHMPCTT
  AVIHEVQHFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWKKPFRFHPEHFLDAQGHFVKPEA
  FLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVAAGQPRPSHSRVVSFLVTPSPYELCAVPR

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR008069  IPR036396  
  • Prosite: PS00086
• Other Databases: GeneCards:  CYP2D7  Malacards:  CYP2D7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0020037	heme binding	IBA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0070330	aromatase activity	IDA	NOT|molecular function
GO:0006805	xenobiotic metabolic process	IDA	NOT|biological process
GO:0070330	aromatase activity	IDA	molecular function
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0042738	exogenous drug catabolic process	IDA	NOT|biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0042738	exogenous drug catabolic process	IDA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse
hsa01522	Endocrine resistance
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq