• Gene id: 156

Gene Summary

• Gene Symbol: GRK2   Gene   UCSC   Ensembl
• Aliases: ADRBK1, BARK1, BETA-ARK1
• Gene name: G protein-coupled receptor kinase 2
• Alternate names: beta-adrenergic receptor kinase 1, adrenergic beta receptor kinase 1, beta-ARK-1,
• Gene location: 11q13.2 (67266419: 67286555)     Exons: 23     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal
• OMIM: 109635

Protein Summary

• Protein general information: P25098  
  • Name: Beta adrenergic receptor kinase 1 (Beta ARK 1) (EC 2.7.11.15) (G protein coupled receptor kinase 2)
  • Length: 689  
  • Mass: 79574
  • Tissue specificity: Expressed in peripheral blood leukocytes. {ECO
• Sequence:

  MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNH
  LEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLACSHPFSKSATEHVQGHLGKKQVPPDLFQPYI
  EEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKK
  RIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
  IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWF
  SLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKES
  PFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETV
  FDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
  LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVEL
  SKVPLVQRGSANGL

• Structural information:
  • Protein Domains: (54..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (191..45-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (454..52-)
    (/note="AGC-kinase-C-terminal)
    (558..65-)
    (/note="PH-)
    (/-)
  • Interpro: IPR000961  IPR000239  IPR011009  IPR011993  IPR001849   IPR000719  IPR017441  IPR016137  IPR036305  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108 PS50132
  • PDB: 1BAK 3CIK 3KRW 3KRX 3V5W 4MK0 4PNK 5HE1 5UKK 5UKL 5UUU 5UVC 5WG3 5WG4 5WG5 6C2Y
  • PDBsum: 1BAK 3CIK 3KRW 3KRX 3V5W 4MK0 4PNK 5HE1 5UKK 5UKL 5UUU 5UVC 5WG3 5WG4 5WG5 6C2Y
  • DIP: 42429
  • STRING: ENSP00000312262
• Other Databases: GeneCards:  GRK2  Malacards:  GRK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045202	synapse	IEA	cellular component
GO:0031623	receptor internalization	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0019079	viral genome replication	IMP	biological process
GO:0046718	viral entry into host cell	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0047696	beta-adrenergic receptor kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0047696	beta-adrenergic receptor kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002029	desensitization of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0002026	regulation of the force of heart contraction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0031694	alpha-2A adrenergic receptor binding	ISS	molecular function
GO:0004672	protein kinase activity	ISS	molecular function
GO:0004703	G protein-coupled receptor kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007217	tachykinin receptor signaling pathway	IDA	biological process
GO:0002029	desensitization of G protein-coupled receptor signaling pathway	ISS	biological process
GO:0003108	negative regulation of the force of heart contraction by chemical signal	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	ISS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0033605	positive regulation of catecholamine secretion	ISS	biological process
GO:0045988	negative regulation of striated muscle contraction	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031755	Edg-2 lysophosphatidic acid receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa04740	Olfactory transduction
hsa04724	Glutamatergic synapse
hsa05032	Morphine addiction
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Pituitary adenoma	PMID:24169548
congestive heart failure	PMID:26248277
Rheumatoid arthritis	PMID:10094932
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq