• Gene id: 1558

Gene Summary

• Gene Symbol: CYP2C8   Gene   UCSC   Ensembl
• Aliases: CPC8, CYP2C8DM, CYPIIC8, MP-12/MP-20
• Gene name: cytochrome P450 family 2 subfamily C member 8
• Alternate names: cytochrome P450 2C8, P450 form 1, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1, cytochrome P450, family 2, subfamily C, polypeptide 8, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8, flavopr,
• Gene location: 10q23.33 (151036320: 151047719)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 601129

Protein Summary

• Protein general information: P10632  
  • Name: Cytochrome P450 2C8 (EC 1.14.14.1) (CYPIIC8) (Cytochrome P450 IIC2) (Cytochrome P450 MP 12) (Cytochrome P450 MP 20) (Cytochrome P450 form 1) (S mephenytoin 4 hydroxylase)
  • Length: 490  
  • Mass: 55825
• Sequence:

  MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIV
  VFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH
  CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDC
  FPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
  TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTK
  FRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT
  TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • PDB: 1PQ2 2NNH 2NNI 2NNJ 2VN0
  • PDBsum: 1PQ2 2NNH 2NNI 2NNJ 2VN0
  • STRING: ENSP00000360317
• Other Databases: GeneCards:  CYP2C8  Malacards:  CYP2C8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0019373	epoxygenase P450 pathway	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0020037	heme binding	IBA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0008392	arachidonic acid epoxygenase activity	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0004497	monooxygenase activity	IDA	molecular function
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0042573	retinoic acid metabolic process	IDA	biological process
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0046456	icosanoid biosynthetic process	IDA	biological process
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0070330	aromatase activity	IEA	molecular function
GO:0019373	epoxygenase P450 pathway	TAS	biological process
GO:0097267	omega-hydroxylase P450 pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0004497	monooxygenase activity	IDA	molecular function
GO:0034875	caffeine oxidase activity	IDA	molecular function
GO:0101020	estrogen 16-alpha-hydroxylase activity	IDA	molecular function
GO:0006082	organic acid metabolic process	IDA	biological process
GO:0017144	drug metabolic process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0042738	exogenous drug catabolic process	IDA	biological process
GO:0070989	oxidative demethylation	IDA	biological process
GO:0008202	steroid metabolic process	IDA	biological process
GO:0002933	lipid hydroxylation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04726	Serotonergic synapse
hsa05204	Chemical carcinogenesis
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00590	Arachidonic acid metabolism
hsa00591	Linoleic acid metabolism

Diseases

Associated diseases	References
Renal hypertension	PMID:20495177
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R