• Gene id: 155185

Gene Summary

• Gene Symbol: AMZ1   Gene   UCSC   Ensembl
• Gene name: archaelysin family metallopeptidase 1
• Alternate names: archaemetzincin-1, archeobacterial metalloproteinase-like protein 1, metalloproteinase-like protein,
• Gene location: 7p22.3 (2679521: 2765186)     Exons: 9     NC_000007.14

Protein Summary

• Protein general information: Q400G9  
  • Name: Archaemetzincin 1 (EC 3.4. . ) (Archeobacterial metalloproteinase like protein 1)
  • Length: 498  
  • Mass: 54924
  • Tissue specificity: Predominantly expressed in heart and liver. Also expressed at lower level in kidney, pancreas and testis. Expressed in fetal tissues such as kidney, liver, lung and brain. {ECO
• Sequence:

  MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLAEAYNPQRTLFCTLLIRTGFDWLLSRPEAPE
  DFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDS
  DRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARFSGEFPKSGPSAPDLA
  LVEAAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQGALSLDEALRRPLDLCPICL
  RKLQHVLGFRLIERYQRLYTWTQAVVGTWPSQEAGEPSVWEDTPPASADSGMCCESDSEPGTSVSEPLTPDAGSH
  TFASGPEEGLSYLAASEAPLPPGGPAEAIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPAT
  RQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDGEES

• Structural information:
  • Interpro: IPR024079  IPR012962  
  • Prosite: PS00142
  • CDD: cd11375
  • STRING: ENSP00000308149
• Other Databases: GeneCards:  AMZ1  Malacards:  AMZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq