• Gene id: 155184

Gene Summary

• Gene Symbol: SLC2A7   Gene   UCSC   Ensembl
• Aliases: GLUT-7, GLUT7, hGLUT7
• Gene name: solute carrier family 2 member 7
• Alternate names: solute carrier family 2, facilitated glucose transporter member 7, glucose transporter type 7, intestinal facilitative glucose transporter 7, solute carrier family 2 (facilitated glucose transporter), member 7,
• Gene location: 1p36.23 (9026383: 8992533)     Exons: 14     NC_000001.11
• Gene summary(Entrez): SLC2A7 belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion (Li et al., 2004). This family of transporters shows conservation of 12 transmembrane helices as well as functionally significant amino acid residu
• OMIM: 615168

Protein Summary

• Protein general information: Q6PXP3  
  • Name: Solute carrier family 2, facilitated glucose transporter member 7 (Glucose transporter type 7) (GLUT 7) (hGLUT7)
  • Length: 512  
  • Mass: 55728
  • Tissue specificity: Expressed in small intestine and colon (PubMed
• Sequence:

  MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETYFERHATFMDGKLMLL
  LWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVSKVAKAFELIVFSRVVLGVCAGISYS
  ALPMYLGELAPKNLRGMVGTMTEVFVIVGVFLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRY
  SLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN
  AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGSACLVLTVVLLFQNRV
  PELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMVDGAVHWLTNFIIGFLFPSIQEAIGAYSFII
  FAGICLLTAIYIYVVIPETKGKTFVEINRIFAKRNRVKLPEEKEETIDAGPPTASPAKETSF

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR003663  IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • PDB: 1YG7
  • PDBsum: 1YG7
  • STRING: ENSP00000383698
• Other Databases: GeneCards:  SLC2A7  Malacards:  SLC2A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0015755	fructose transmembrane transport	IDA	NOT|biological process
GO:1904659	glucose transmembrane transport	IDA	NOT|biological process
GO:0005355	glucose transmembrane transporter activity	IDA	NOT|molecular function
GO:0005353	fructose transmembrane transporter activity	IDA	NOT|molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0015755	fructose transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq