• Gene id: 155051

Gene Summary

• Gene Symbol: CRYGN   Gene   UCSC   Ensembl
• Gene name: crystallin gamma N
• Alternate names: gamma-crystallin N, gamma-N-crystallin, gammaN-crystallin,
• Gene location: 7q36.1 (151448789: 151428831)     Exons: 7     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the crystallin family of proteins that are localized to the refractive structure of vertebrate eye lenses. The protein encoded by this gene is unique in that it has both beta and gamma crystallin protein motifs. Alternative s
• OMIM: 601456

Protein Summary

• Protein general information: Q8WXF5  
  • Name: Gamma crystallin N (Gamma N crystallin)
  • Length: 182  
  • Mass: 20624
  • Tissue specificity: Not specifically expressed in eye. {ECO
• Sequence:

  MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRW
  NSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAED
  FQLSSSLQSDQGPEEATTKPATTQPPFLTANL

• Structural information:
  • Protein Domains: (6..4-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (47..8-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (95..13-)
    (/note="Beta/gam-)
  • Interpro: IPR001064  IPR011024  
  • Prosite: PS50915
  • STRING: ENSP00000338613
• Other Databases: GeneCards:  CRYGN  Malacards:  CRYGN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002088	lens development in camera-type eye	IBA	biological process
GO:0007601	visual perception	IBA	biological process
GO:0005212	structural constituent of eye lens	IBA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881