• Gene id: 155

Gene Summary

• Gene Symbol: ADRB3   Gene   UCSC   Ensembl
• Aliases: BETA3AR
• Gene name: adrenoceptor beta 3
• Alternate names: beta-3 adrenergic receptor, adrenergic, beta-3-, receptor, beta-3 adrenoceptor, beta-3 adrenoreceptor,
• Gene location: 8p11.23 (37966598: 37962989)     Exons: 2     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the family of beta adrenergic receptors, which mediate catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor is located mainly in the adipose tissue and is involve
• OMIM: 109691

SNPs

rs11568732

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.94761817T>C
NC_000010.11   g.94761817T>G
NC_000010.10   g.96521574T>C
NC_000010.10   g.96521574T>G
NG_008384.3   g.4137T>C
NG_008384.3   g.4137T>G
NG_055436.1   g.1177T>C
NG_055436.1   g.1177T>G|SEQ=[T/C/G]|GENE=CYP2C19

rs1042389

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.41018248T>C
NC_000019.9   g.41524153T>C
NG_007929.1   g.31950T>C
NM_000767.5   c.*1421T>C
NM_000767.4   c.*1421T>C|SEQ=[T/C]|GENE=CYP2B6

rs4986894

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.94762608T>C
NC_000010.10   g.96522365T>C
NG_008384.3   g.4928T>C
NG_055436.1   g.1968T>C|SEQ=[T/C]|GENE=CYP2C19

Protein Summary

• Protein general information: P13945  
  • Name: Beta 3 adrenergic receptor (Beta 3 adrenoreceptor) (Beta 3 adrenoceptor)
  • Length: 408  
  • Mass: 43519
  • Tissue specificity: Expressed mainly in adipose tissues.
• Sequence:

  MAPWPHENSSLAPWPDLPTLAPNTANTSGLPGVPWEAALAGALLALAVLATVGGNLLVIVAIAWTPRLQTMTNVF
  VTSLAAADLVMGLLVVPPAATLALTGHWPLGATGCELWTSVDVLCVTASIETLCALAVDRYLAVTNPLRYGALVT
  KRCARTAVVLVWVVSAAVSFAPIMSQWWRVGADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYA
  RVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPARLLPLREHRALCTLGLIMGT
  FTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLLCRCGRRLPPEPCAAA
  RPALFPSGVPAARSSPAQPRLCQRLDGASWGVS

• Structural information:
  • Interpro: IPR002233  IPR000681  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 2CDW
  • PDBsum: 2CDW
  • DIP: 61451
  • STRING: ENSP00000343782
• Other Databases: GeneCards:  ADRB3  Malacards:  ADRB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051380	norepinephrine binding	IDA	contributes to
GO:0006898	receptor-mediated endocytosis	IDA	NOT|biological process
GO:0007190	activation of adenylate cyclase activity	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0004939	beta-adrenergic receptor activity	IDA	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0015052	beta3-adrenergic receptor activity	IMP	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0002032	desensitization of G protein-coupled receptor signaling pathway by arrestin	IDA	NOT|biological process
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0051379	epinephrine binding	IBA	molecular function
GO:0015052	beta3-adrenergic receptor activity	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0002025	norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IBA	biological process
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004939	beta-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006112	energy reserve metabolic process	TAS	biological process
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04714	Thermogenesis
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04970	Salivary secretion
hsa04924	Renin secretion
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Genetic obesity	KEGG:H02106
Genetic obesity	KEGG:H02106
Non-alcoholic fatty liver disease	PMID:15318095
Dilated cardiomyopathy 1H	PMID:20123316
Alzheimer's disease	PMID:17440948
Hypertension	PMID:10981554
Gout	PMID:21285172
Endometrial cancer	PMID:15743038
Cystic fibrosis	PMID:20203292
Coronary artery disease	PMID:9126344
congestive heart failure	PMID:11273992
Rheumatoid arthritis	PMID:12739037
Diabetic retinopathy	PMID:9313761
type 2 diabetes mellitus	PMID:17727676
type 2 diabetes mellitus	PMID:16444766
obesity	PMID:9126344
obesity	PMID:9892244
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)