• Gene id: 1549

Gene Summary

• Gene Symbol: CYP2A7   Gene   UCSC   Ensembl
• Aliases: CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4
• Gene name: cytochrome P450 family 2 subfamily A member 7
• Alternate names: cytochrome P450 2A7, cytochrome P450 IIA4, cytochrome P450, family 2, subfamily A, polypeptide 7, cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 7, cytochrome P450IIA4,
• Gene location: 19q13.2 (40885950: 40875438)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 608054

Protein Summary

• Protein general information: P20853  
  • Name: Cytochrome P450 2A7 (EC 1.14.14.1) (CYPIIA7) (Cytochrome P450 IIA4)
  • Length: 494  
  • Mass: 56425
• Sequence:

  MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFTIHLGP
  RRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGVGKRGIEERIQ
  EESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSS
  VMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
  AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVK
  KDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGLARMELF
  LFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMSFLPR

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR008067  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000301146
• Other Databases: GeneCards:  CYP2A7  Malacards:  CYP2A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0008392	arachidonic acid epoxygenase activity	IBA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0020037	heme binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0009804	coumarin metabolic process	IBA	biological process
GO:0019373	epoxygenase P450 pathway	IBA	biological process
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019825	oxygen binding	TAS	molecular function
GO:0070330	aromatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)