• Gene id: 154807

Gene Summary

• Gene Symbol: VKORC1L1   Gene   UCSC   Ensembl
• Gene name: vitamin K epoxide reductase complex subunit 1 like 1
• Alternate names: vitamin K epoxide reductase complex subunit 1-like protein 1, VKORC1-like protein 1,
• Gene location: 7q11.21 (65865771: 65959557)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene encodes an enzyme important in the vitamin K cycle, which is involved in the carboxylation of glutamate residues present in vitamin K-dependent proteins. The encoded enzyme catalyzes the de-epoxidation of vitamin K 2,3-epoxide. Oxidative stress
• OMIM: 618611

Protein Summary

• Protein general information: Q8N0U8  
  • Name: Vitamin K epoxide reductase complex subunit 1 like protein 1 (VKORC1 like protein 1) (EC 1.17.4.4)
  • Length: 176  
  • Mass: 19836
• Sequence:

  MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSAALASRWGRGFGLLGS
  IFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMSVVGSLYLAYILYFVLKEFCIICIVTYVLNF
  LLLIINYKRLVYLNEAWKRQLQPKQD

• Structural information:
  • Interpro: IPR012932  IPR038354  IPR042406  
  • CDD: cd12917
• Other Databases: GeneCards:  VKORC1L1  Malacards:  VKORC1L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047057	vitamin-K-epoxide reductase (warfarin-sensitive) activity	IBA	molecular function
GO:0042373	vitamin K metabolic process	IBA	biological process
GO:0017187	peptidyl-glutamic acid carboxylation	IBA	biological process
GO:0047057	vitamin-K-epoxide reductase (warfarin-sensitive) activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0042373	vitamin K metabolic process	IDA	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0017187	peptidyl-glutamic acid carboxylation	IMP	biological process
GO:0047057	vitamin-K-epoxide reductase (warfarin-sensitive) activity	IEA	molecular function
GO:0042373	vitamin K metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0048038	quinone binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047057	vitamin-K-epoxide reductase (warfarin-sensitive) activity	EXP	molecular function
GO:0047057	vitamin-K-epoxide reductase (warfarin-sensitive) activity	EXP	molecular function
GO:0042373	vitamin K metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00130	Ubiquinone and other terpenoid-quinone biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881