• Gene id: 153769

Gene Summary

• Gene Symbol: SH3RF2   Gene   UCSC   Ensembl
• Aliases: HEPP1, POSHER, PPP1R39, RNF158
• Gene name: SH3 domain containing ring finger 2
• Alternate names: E3 ubiquitin-protein ligase SH3RF2, POSH-eliminating RING protein, RING finger protein 158, RING-type E3 ubiquitin transferase SH3RF2, SH3 domain-containing RING finger protein 2, heart protein phosphatase 1-binding protein, phosphatase 1 binding protein, protei,
• Gene location: 5q32 (145936569: 146081772)     Exons: 11     NC_000005.10
• OMIM: 613377

Protein Summary

• Protein general information: Q8TEC5  
  • Name: E3 ubiquitin protein ligase SH3RF2 (EC 2.3.2.27) (Heart protein phosphatase 1 binding protein) (HEPP1) (POSH eliminating RING protein) (Protein phosphatase 1 regulatory subunit 39) (RING finger protein 158) (RING type E3 ubiquitin transferase SH3RF2) (SH3
  • Length: 729  
  • Mass: 79320
  • Tissue specificity: Heart (at protein level). Up-regulated in colon cancer tissues as compared to normal colon tissues (at protein level). Testis. In the heart, present in the apex, left atrium, right atrium, left ventricle and right ventricle, but not in
• Sequence:

  MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRVFKAHKELRCPECRTPVFSNIEALPANLLLVRLLDG
  VRSGQSSGRGGSFRRPGTMTLQDGRKSRTNPRRLQASPFRLVPNVRIHMDGVPRAKALCNYRGQNPGDLRFNKGD
  IILLRRQLDENWYQGEINGISGNFPASSVEVIKQLPQPPPLCRALYNFDLRGKDKSENQDCLTFLKDDIITVISR
  VDENWAEGKLGDKVGIFPILFVEPNLTARHLLEKNKGRQSSRTKNLSLVSSSSRGNTSTLRRGPGSRRKVPGQFS
  ITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQPMEKADVPSSCVGQVSTYHPAPVSPGHSTAVVSLPG
  SQQHLSANMFVALHSYSAHGPDELDLQKGEGVRVLGKCQDGWLRGVSLVTGRVGIFPNNYVIPIFRKTSSFPDSR
  SPGLYTTWTLSTSSVSSQGSISEGDPRQSRPFKSVFVPTAIVNPVRSTAGPGTLGQGSLRKGRSSMRKNGSLQRP
  LQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEAWIHSAASSL
  IMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQ
  PEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALGKATTLVSTASGTQTVFPSK

• Structural information:
  • Protein Domains: (125..18-)
    (/note="SH3-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (187..25-)
    (/note="SH3-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (380..44-)
    (/note="SH3-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR036028  IPR001452  IPR028511  IPR035792  IPR035794   IPR035822  IPR027370  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50002 PS00518 PS50089
  • CDD: cd11929 cd11932 cd11784
  • STRING: ENSP00000424497
• Other Databases: GeneCards:  SH3RF2  Malacards:  SH3RF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0010923	negative regulation of phosphatase activity	IBA	biological process
GO:0008157	protein phosphatase 1 binding	IDA	molecular function
GO:0019902	phosphatase binding	IDA	molecular function
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0051865	protein autoubiquitination	IMP	biological process
GO:0046329	negative regulation of JNK cascade	ISS	biological process
GO:0046328	regulation of JNK cascade	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0046329	negative regulation of JNK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)