• Gene id: 153222

Gene Summary

• Gene Symbol: CREBRF   Gene   UCSC   Ensembl
• Aliases: C5orf41, LRF
• Gene name: CREB3 regulatory factor
• Alternate names: CREB3 regulatory factor, UPF0474 protein C5orf41, adult retina protein, luman recruitment factor, luman-recruiting factor, luman/CREB3 recruitment factor,
• Gene location: 5q35.1 (173056348: 173139283)     Exons: 10     NC_000005.10
• OMIM: 617109

Protein Summary

• Protein general information: Q8IUR6  
  • Name: CREB3 regulatory factor (Luman recruitment factor) (LRF)
  • Length: 639  
  • Mass: 72149
• Sequence:

  MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFLSLEDCKDIENLESFT
  DVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLAQLNSEDSQSV
  SDSLYYPDSLFSVKQNPLPSSFPGKKITSRAAAPVCSSKTLQAEVPLSDCVQKASKPTSSTQIMVKTNMYHNEKV
  NFHVECKDYVKKAKVKINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGMEPLQGHATPALPFKETQELLL
  SPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPTKCSPEEDEEDEEDVDDEDHDEGFGS
  EHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEVTSISSRKRGKRRYFWEYSEQLTPSQQERML
  RPSEWNRDTLPSNMYQKNGLHHGKYAVKKSRRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPR
  SRKEKNKLASRACRLKKKAQYEANKVKLWGLNTEYDNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDT
  LGLPVAGQTSEFVNQVLEKTAEGNPTGGLVGLRIPTSKV

• Structural information:
  • Protein Domains: (521..58-)
    (/note="bZIP"-)
  • Interpro: IPR004827  IPR039165  
  • Prosite: PS00036
  • STRING: ENSP00000296953
• Other Databases: GeneCards:  CREBRF  Malacards:  CREBRF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006986	response to unfolded protein	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0030968	endoplasmic reticulum unfolded protein response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900170	negative regulation of glucocorticoid mediated signaling pathway	IEA	biological process
GO:1902213	positive regulation of prolactin signaling pathway	IEA	biological process
GO:0016604	nuclear body	IEA	cellular component
GO:0042711	maternal behavior	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)