• Gene id: 153129

Gene Summary

• Gene Symbol: SLC38A9   Gene   UCSC   Ensembl
• Aliases: URLC11
• Gene name: solute carrier family 38 member 9
• Alternate names: sodium-coupled neutral amino acid transporter 9, putative sodium-coupled neutral amino acid transporter 9, up-regulated in lung cancer 11,
• Gene location: 5q11.2 (55712342: 55625844)     Exons: 21     NC_000005.10
• OMIM: 616203

Protein Summary

• Protein general information: Q8NBW4  
  • Name: Sodium coupled neutral amino acid transporter 9 (Solute carrier family 38 member 9) (Up regulated in lung cancer 11)
  • Length: 561  
  • Mass: 63776
• Sequence:

  MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLT
  TPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTG
  MCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLF
  NTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLL
  PLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNC
  IITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQ
  MMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLI
  YIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM

• Structural information:
  • Interpro: IPR013057  
  • DIP: 61480
  • STRING: ENSP00000380074
• Other Databases: GeneCards:  SLC38A9  Malacards:  SLC38A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0032008	positive regulation of TOR signaling	IDA	biological process
GO:0071230	cellular response to amino acid stimulus	IDA	biological process
GO:0071986	Ragulator complex	IDA	colocalizes with
GO:0005764	lysosome	IDA	cellular component
GO:0032008	positive regulation of TOR signaling	IDA	biological process
GO:0071230	cellular response to amino acid stimulus	IDA	biological process
GO:0071986	Ragulator complex	IDA	colocalizes with
GO:0005764	lysosome	IDA	cellular component
GO:0061459	L-arginine transmembrane transporter activity	IDA	molecular function
GO:0071230	cellular response to amino acid stimulus	IDA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0015171	amino acid transmembrane transporter activity	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:0003333	amino acid transmembrane transport	IDA	biological process
GO:0015171	amino acid transmembrane transporter activity	IDA	molecular function
GO:0015190	L-leucine transmembrane transporter activity	IDA	molecular function
GO:0003333	amino acid transmembrane transport	IDA	biological process
GO:1905103	integral component of lysosomal membrane	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0006865	amino acid transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:1903400	L-arginine transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0015804	neutral amino acid transport	IEA	biological process
GO:0015803	branched-chain amino acid transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881