• Gene id: 153090

Gene Summary

• Gene Symbol: DAB2IP   Gene   UCSC   Ensembl
• Aliases: AF9Q34, AIP-1, AIP1, DIP1/2
• Gene name: DAB2 interacting protein
• Alternate names: disabled homolog 2-interacting protein, ASK-interacting protein 1, ASK1-interacting protein 1, DAB2 interaction protein, DOC-2/DAB2 interactive protein, nGAP-like protein,
• Gene location: 9q33.2 (28335670: 28347008)     Exons: 7     NC_000017.11
• Gene summary(Entrez): DAB2IP is a Ras (MIM 190020) GTPase-activating protein (GAP) that acts as a tumor suppressor. The DAB2IP gene is inactivated by methylation in prostate and breast cancers (Yano et al., 2005 [PubMed 15386433]).[supplied by OMIM, May 2010]
• OMIM: 609205

Protein Summary

• Protein general information: Q5VWQ8  
  • Name: Disabled homolog 2 interacting protein (DAB2 interaction protein) (DAB2 interacting protein) (ASK interacting protein 1) (AIP 1) (DOC 2/DAB 2 interactive protein)
  • Length: 1189  
  • Mass: 131625
  • Tissue specificity: Expressed in endothelial and vascular smooth muscle cells (VSMCs). Expressed in prostate epithelial but poorly in prostate cancer cells. Poorly expressed in medulloblastoma cells compared to cerebellar precursor proliferating progenito
• Sequence:

  MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSEKSPSMEPSAATPFRV
  TGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLS
  MEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDL
  PAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
  VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEM
  ASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDE
  NCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRF
  LCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
  LSNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGS
  SSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGGKSLSMVD
  LQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAP
  LSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG
  GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSK
  GDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLR
  ISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVD
  SKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC

• Structural information:
  • Protein Domains: (101..20-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (193..31-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (371..56-)
    (/note="Ras-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00167"-)
  • Interpro: IPR000008  IPR035892  IPR030403  IPR021887  IPR011993   IPR001849  IPR039360  IPR023152  IPR001936  IPR008936  
  • Prosite: PS50004 PS50003 PS00509 PS50018
  • DIP: 41721
  • STRING: ENSP00000259371
• Other Databases: GeneCards:  DAB2IP  Malacards:  DAB2IP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019901	protein kinase binding	IDA	molecular function
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:1990597	AIP1-IRE1 complex	IDA	cellular component
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:0034620	cellular response to unfolded protein	TAS	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0070317	negative regulation of G0 to G1 transition	IDA	biological process
GO:0070273	phosphatidylinositol-4-phosphate binding	IDA	molecular function
GO:0044257	cellular protein catabolic process	IDA	biological process
GO:0043548	phosphatidylinositol 3-kinase binding	IDA	molecular function
GO:0043254	regulation of protein-containing complex assembly	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0036312	phosphatidylinositol 3-kinase regulatory subunit binding	IDA	molecular function
GO:0017124	SH3 domain binding	IDA	molecular function
GO:0017124	SH3 domain binding	IDA	molecular function
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0000185	activation of MAPKKK activity	IDA	biological process
GO:2001235	positive regulation of apoptotic signaling pathway	IDA	biological process
GO:1903363	negative regulation of cellular protein catabolic process	IDA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0071158	positive regulation of cell cycle arrest	IDA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043553	negative regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035662	Toll-like receptor 4 binding	IDA	NOT|molecular function
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	IDA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1990032	parallel fiber	ISS	cellular component
GO:1900006	positive regulation of dendrite development	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0044301	climbing fiber	ISS	cellular component
GO:0044300	cerebellar mossy fiber	ISS	cellular component
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0035148	tube formation	IMP	biological process
GO:0034260	negative regulation of GTPase activity	ISS	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0030424	axon	ISS	cellular component
GO:0021819	layer formation in cerebral cortex	ISS	biological process
GO:0021814	cell motility involved in cerebral cortex radial glia guided migration	ISS	biological process
GO:0010596	negative regulation of endothelial cell migration	IMP	biological process
GO:0007252	I-kappaB phosphorylation	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:2001224	positive regulation of neuron migration	ISS	biological process
GO:1901800	positive regulation of proteasomal protein catabolic process	IMP	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	ISS	biological process
GO:1900744	regulation of p38MAPK cascade	ISS	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0043184	vascular endothelial growth factor receptor 2 binding	IPI	molecular function
GO:0043025	neuronal cell body	ISS	cellular component
GO:0036324	vascular endothelial growth factor receptor-2 signaling pathway	ISS	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	ISS	biological process
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0043087	regulation of GTPase activity	ISS	biological process
GO:0031434	mitogen-activated protein kinase kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0010633	negative regulation of epithelial cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0038026	reelin-mediated signaling pathway	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0040008	regulation of growth	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001224	positive regulation of neuron migration	IEA	biological process
GO:1990597	AIP1-IRE1 complex	IEA	cellular component
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IEA	biological process
GO:1900744	regulation of p38MAPK cascade	IEA	biological process
GO:0090129	positive regulation of synapse maturation	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0036324	vascular endothelial growth factor receptor-2 signaling pathway	IEA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEA	biological process
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1990032	parallel fiber	IEA	cellular component
GO:1900006	positive regulation of dendrite development	IEA	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0044301	climbing fiber	IEA	cellular component
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0043254	regulation of protein-containing complex assembly	IEA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0035148	tube formation	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0021819	layer formation in cerebral cortex	IEA	biological process
GO:0021814	cell motility involved in cerebral cortex radial glia guided migration	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0010596	negative regulation of endothelial cell migration	IEA	biological process
GO:0007252	I-kappaB phosphorylation	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0005123	death receptor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0051721	protein phosphatase 2A binding	IDA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IPI	molecular function
GO:0007257	activation of JUN kinase activity	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IC	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IMP	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0010633	negative regulation of epithelial cell migration	TAS	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	IMP	biological process
GO:0048147	negative regulation of fibroblast proliferation	ISS	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	ISS	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0072577	endothelial cell apoptotic process	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04210	Apoptosis
hsa04668	TNF signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray