• Gene id: 153

Gene Summary

• Gene Symbol: ADRB1   Gene   UCSC   Ensembl
• Aliases: ADRB1R, B1AR, BETA1AR, FNSS2, RHR
• Gene name: adrenoceptor beta 1
• Alternate names: beta-1 adrenergic receptor, adrenergic, beta-1-, receptor, beta-1 adrenoceptor, beta-1 adrenoreceptor,
• Gene location: 10q25.3 (114043865: 114046903)     Exons: 1     NC_000010.11
• Gene summary(Entrez): The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter
• OMIM: 610775

Protein Summary

• Protein general information: P08588  
  • Name: Beta 1 adrenergic receptor (Beta 1 adrenoreceptor) (Beta 1 adrenoceptor)
  • Length: 477  
  • Mass: 51323
• Sequence:

  MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVLLIVAG
  NVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLC
  VIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYA
  IASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
  LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPI
  IYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG
  CNGGAAADSDSSLDEPCRPGFASESKV

• Structural information:
  • Interpro: IPR002233  IPR000507  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 2LSQ
  • PDBsum: 2LSQ
  • DIP: 36294
  • STRING: ENSP00000358301
• Other Databases: GeneCards:  ADRB1  Malacards:  ADRB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004940	beta1-adrenergic receptor activity	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0051379	epinephrine binding	IBA	molecular function
GO:0051380	norepinephrine binding	IBA	molecular function
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0001996	positive regulation of heart rate by epinephrine-norepinephrine	IBA	biological process
GO:0002025	norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IDA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0004940	beta1-adrenergic receptor activity	IEA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045823	positive regulation of heart contraction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004940	beta1-adrenergic receptor activity	TAS	molecular function
GO:0004939	beta-adrenergic receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099579	G protein-coupled neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IEA	biological process
GO:0042596	fear response	IEA	biological process
GO:0031649	heat generation	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004940	beta1-adrenergic receptor activity	IEA	molecular function
GO:0002024	diet induced thermogenesis	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0040015	negative regulation of multicellular organism growth	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009409	response to cold	IEA	biological process
GO:0002025	norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IEA	biological process
GO:0001997	positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA	biological process
GO:0001996	positive regulation of heart rate by epinephrine-norepinephrine	IEA	biological process
GO:0031694	alpha-2A adrenergic receptor binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IDA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa05414	Dilated cardiomyopathy
hsa04970	Salivary secretion
hsa04540	Gap junction
hsa04924	Renin secretion
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Sleep apnea	PMID:20948559
Hypertension	PMID:20398560
Nephrosclerosis	PMID:19745105
low tension glaucoma	PMID:16785856
Cystic fibrosis	PMID:20203292
Aortic valve stenosis	PMID:1648674
Chronic obstructive pulmonary disease	PMID:11527135
congestive heart failure	PMID:14502278
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881