• Gene id: 152816

Gene Summary

• Gene Symbol: ODAPH   Gene   UCSC   Ensembl
• Aliases: AI2A4, C4orf26
• Gene name: odontogenesis associated phosphoprotein
• Alternate names: odontogenesis associated phosphoprotein, amelogenesis imperfecta type IIA4, uncharacterized protein C4orf26,
• Gene location: 4q21.1 (75554996: 75565892)     Exons: 6     NC_000004.12
• Gene summary(Entrez): Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this
• OMIM: 604159

Protein Summary

• Protein general information: Q17RF5  
  • Name: Odontogenesis associated phosphoprotein
  • Length: 130  
  • Mass: 15556
  • Tissue specificity: Highly expressed in placenta. {ECO
• Sequence:

  MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFF
  PRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

• Structural information:
  • Interpro: IPR031706  
  • STRING: ENSP00000406925
• Other Databases: GeneCards:  ODAPH  Malacards:  ODAPH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070175	positive regulation of enamel mineralization	IBA	biological process
GO:0070169	positive regulation of biomineral tissue development	IMP	biological process
GO:0070175	positive regulation of enamel mineralization	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Amelogenesis imperfecta	KEGG:H00615
Amelogenesis imperfecta	KEGG:H00615
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881