• Gene id: 152559

Gene Summary

• Gene Symbol: PAQR3   Gene   UCSC   Ensembl
• Aliases: RKTG
• Gene name: progestin and adipoQ receptor family member 3
• Alternate names: progestin and adipoQ receptor family member 3, Raf kinase trapping to Golgi, progestin and adipoQ receptor family member III,
• Gene location: 4q21.21 (78939437: 78887224)     Exons: 15     NC_000004.12
• Gene summary(Entrez): This gene encodes a seven-transmembrane protein localized in the Golgi apparatus in mammalian cells. The encoded protein belongs to the progestin and adipoQ receptor (PAQR) family. This protein functions as a tumor suppressor by inhibiting the Raf/MEK/ERK
• OMIM: 614577

Protein Summary

• Protein general information: Q6TCH7  
  • Name: Progestin and adipoQ receptor family member 3 (Progestin and adipoQ receptor family member III) (Raf kinase trapping to Golgi) (RKTG)
  • Length: 311  
  • Mass: 36217
  • Tissue specificity: Widely expressed in a range of tissues. {ECO
• Sequence:

  MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWS
  HLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISI
  GILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLN
  GGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRH
  SKPCPDYVSHL

• Structural information:
  • Interpro: IPR004254  
  • DIP: 46464
  • STRING: ENSP00000421981
• Other Databases: GeneCards:  PAQR3  Malacards:  PAQR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0034067	protein localization to Golgi apparatus	IPI	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)