• Gene id: 1525

Gene Summary

• Gene Symbol: CXADR   Gene   UCSC   Ensembl
• Aliases: CAR, CAR4/6, HCAR
• Gene name: CXADR Ig-like cell adhesion molecule
• Alternate names: coxsackievirus and adenovirus receptor, 46 kD coxsackievirus and adenovirus receptor (CAR) protein, CVB3-binding protein, HCVADR, coxsackie virus and adenovirus receptor, coxsackievirus B-adenovirus receptor,
• Gene location: 21q21.1 (17512905: 17636212)     Exons: 10     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosom
• OMIM: 602621

Protein Summary

• Protein general information: P78310  
  • Name: Coxsackievirus and adenovirus receptor (CAR) (hCAR) (CVB3 binding protein) (Coxsackievirus B adenovirus receptor) (HCVADR)
  • Length: 365  
  • Mass: 40030
  • Tissue specificity: Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is fo
• Sequence:

  MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYS
  GDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDG
  SEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLL
  RLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
  SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV

• Structural information:
  • Protein Domains: (20..13-)
    1 (/note="Ig-like-C2-type)
    (141..22-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR013151  
  • Prosite: PS50835
  • PDB: 1EAJ 1F5W 1JEW 1KAC 1P69 1P6A 1RSF 2J12 2J1K 2NPL 2W9L 2WBW 3J6L 3J6M 3J6N 3J6O
  • PDBsum: 1EAJ 1F5W 1JEW 1KAC 1P69 1P6A 1RSF 2J12 2J1K 2NPL 2W9L 2WBW 3J6L 3J6M 3J6N 3J6O
  • STRING: ENSP00000284878
• Other Databases: GeneCards:  CXADR  Malacards:  CXADR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0046629	gamma-delta T cell activation	ISS	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0008354	germ cell migration	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0048739	cardiac muscle fiber development	IEA	biological process
GO:0071253	connexin binding	IEA	molecular function
GO:0086067	AV node cell to bundle of His cell communication	IEA	biological process
GO:0086072	AV node cell-bundle of His cell adhesion involved in cell communication	IEA	biological process
GO:0098904	regulation of AV node cell action potential	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0007005	mitochondrion organization	IEA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0014704	intercalated disc	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0045216	cell-cell junction organization	IEA	biological process
GO:0046629	gamma-delta T cell activation	IEA	biological process
GO:0060044	negative regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0086082	cell adhesive protein binding involved in AV node cell-bundle of His cell communication	IC	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0007507	heart development	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0086072	AV node cell-bundle of His cell adhesion involved in cell communication	ISS	biological process
GO:0098904	regulation of AV node cell action potential	ISS	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0016327	apicolateral plasma membrane	IDA	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0007507	heart development	ISS	biological process
GO:0005886	plasma membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:0045216	cell-cell junction organization	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0030593	neutrophil chemotaxis	IMP	biological process
GO:0030175	filopodium	ISS	cellular component
GO:0070633	transepithelial transport	IMP	biological process
GO:0044297	cell body	ISS	cellular component
GO:0010669	epithelial structure maintenance	IMP	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0007005	mitochondrion organization	ISS	biological process
GO:0086067	AV node cell to bundle of His cell communication	ISS	biological process
GO:0071253	connexin binding	ISS	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0048739	cardiac muscle fiber development	ISS	biological process
GO:0008354	germ cell migration	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05416	Viral myocarditis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R