• Gene id: 1524

Gene Summary

• Gene Symbol: CX3CR1   Gene   UCSC   Ensembl
• Aliases: CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
• Gene name: C-X3-C motif chemokine receptor 1
• Alternate names: CX3C chemokine receptor 1, C-X3-C CKR-1, CMK-BRL-1, CMK-BRL1, G-protein coupled receptor 13, beta chemokine receptor-like 1, chemokine (C-C) receptor-like 1, chemokine (C-X3-C motif) receptor 1, chemokine (C-X3-C) receptor 1, fractalkine receptor,
• Gene location: 3p22.2 (39281734: 39263493)     Exons: 5     NC_000003.12
• Gene summary(Entrez): Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene
• OMIM: 601470

Protein Summary

• Protein general information: P49238  
  • Name: CX3C chemokine receptor 1 (C X3 C CKR 1) (CX3CR1) (Beta chemokine receptor like 1) (CMK BRL 1) (CMK BRL1) (Fractalkine receptor) (G protein coupled receptor 13) (V28)
  • Length: 355  
  • Mass: 40396
  • Tissue specificity: Expressed in lymphoid and neural tissues.
• Sequence:

  MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLAL
  SDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTIS
  LGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHK
  KAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
  RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

• Structural information:
  • Interpro: IPR005387  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5879
  • STRING: ENSP00000351059
• Other Databases: GeneCards:  CX3CR1  Malacards:  CX3CR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098883	synapse pruning	IC	biological process
GO:0045087	innate immune response	IC	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0004930	G protein-coupled receptor activity	ISS	molecular function
GO:0019960	C-X3-C chemokine binding	ISS	molecular function
GO:0008528	G protein-coupled peptide receptor activity	TAS	molecular function
GO:0002931	response to ischemia	ISS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0110091	negative regulation of hippocampal neuron apoptotic process	ISS	biological process
GO:0150090	multiple spine synapse organization, single dendrite	ISS	biological process
GO:0006935	chemotaxis	IGI	biological process
GO:0007155	cell adhesion	ISS	biological process
GO:0035425	autocrine signaling	ISS	biological process
GO:0035176	social behavior	ISS	biological process
GO:0042534	regulation of tumor necrosis factor biosynthetic process	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:1904139	regulation of microglial cell migration	TAS	biological process
GO:1903721	positive regulation of I-kappaB phosphorylation	ISS	biological process
GO:0097447	dendritic tree	ISS	cellular component
GO:0045428	regulation of nitric oxide biosynthetic process	ISS	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	ISS	biological process
GO:0002052	positive regulation of neuroblast proliferation	ISS	biological process
GO:0050769	positive regulation of neurogenesis	ISS	biological process
GO:0048167	regulation of synaptic plasticity	TAS	biological process
GO:0009986	cell surface	TAS	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0032691	negative regulation of interleukin-1 beta production	ISS	biological process
GO:0021626	central nervous system maturation	ISS	biological process
GO:0050901	leukocyte tethering or rolling	ISS	biological process
GO:0060074	synapse maturation	ISS	biological process
GO:0050767	regulation of neurogenesis	TAS	biological process
GO:0050804	modulation of chemical synaptic transmission	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0016495	C-X3-C chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:1900272	negative regulation of long-term synaptic potentiation	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0060074	synapse maturation	IEA	biological process
GO:0050901	leukocyte tethering or rolling	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0045428	regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:1904141	positive regulation of microglial cell migration	IEA	biological process
GO:1903721	positive regulation of I-kappaB phosphorylation	IEA	biological process
GO:0110091	negative regulation of hippocampal neuron apoptotic process	IEA	biological process
GO:0097447	dendritic tree	IEA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0035425	autocrine signaling	IEA	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0016495	C-X3-C chemokine receptor activity	IEA	molecular function
GO:0007613	memory	IEA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0150090	multiple spine synapse organization, single dendrite	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0042534	regulation of tumor necrosis factor biosynthetic process	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0021626	central nervous system maturation	IEA	biological process
GO:0019960	C-X3-C chemokine binding	IEA	molecular function
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Age-related macular degeneration	KEGG:H00821
Coronary artery disease	KEGG:H01742
Age-related macular degeneration	KEGG:H00821
Coronary artery disease	KEGG:H01742
Otitis media	PMID:24718616
Asthma	PMID:17082760
Atopic dermatitis	PMID:15131578
systemic scleroderma	PMID:15608300
systemic scleroderma	PMID:16584113
macular degeneration	PMID:22816662
Pulmonary hypertension	PMID:16584113
Psoriasis	PMID:17002687
Systemic lupus erythematosus	PMID:21180278
obesity	PMID:20523302
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray