• Gene id: 1522

Gene Summary

• Gene Symbol: CTSZ   Gene   UCSC   Ensembl
• Aliases: CTSX
• Gene name: cathepsin Z
• Alternate names: cathepsin Z, carboxypeptidase LB, cathepsin B2, cathepsin IV, cathepsin P, cathepsin X, cathepsin Y, cathepsin Z1, cysteine-type carboxypeptidase, lysosomal carboxypeptidase B, preprocathepsin P,
• Gene location: 20q13.32 (59007253: 58995184)     Exons: 6     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. T
• OMIM: 602090

Protein Summary

• Protein general information: Q9UBR2  
  • Name: Cathepsin Z (EC 3.4.18.1) (Cathepsin P) (Cathepsin X)
  • Length: 303  
  • Mass: 33868
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVN
  YASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIP
  DETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANY
  TGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
  PIV

• Structural information:
  • Interpro: IPR033157  IPR038765  IPR025661  IPR000668  
  • Prosite: PS00640
  • CDD: cd02698
  • PDB: 1DEU 1EF7
  • PDBsum: 1DEU 1EF7
  • STRING: ENSP00000217131
• Other Databases: GeneCards:  CTSZ  Malacards:  CTSZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051603	proteolysis involved in cellular protein catabolic process	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0002003	angiotensin maturation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:2000179	positive regulation of neural precursor cell proliferation	IEA	biological process
GO:0099738	cell cortex region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:1901214	regulation of neuron death	IGI	biological process
GO:0006508	proteolysis	IMP	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0004180	carboxypeptidase activity	IMP	molecular function
GO:0010757	negative regulation of plasminogen activation	IMP	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome
hsa04210	Apoptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R