• Gene id: 152189

Gene Summary

• Gene Symbol: CMTM8   Gene   UCSC   Ensembl
• Aliases: CKLFSF8, CKLFSF8-V2
• Gene name: CKLF like MARVEL transmembrane domain containing 8
• Alternate names: CKLF-like MARVEL transmembrane domain-containing protein 8, chemokine-like factor superfamily member 8,
• Gene location: 3p22.3 (32238678: 32370324)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene

Protein Summary

• Protein general information: Q8IZV2  
  • Name: CKLF like MARVEL transmembrane domain containing protein 8 (Chemokine like factor superfamily member 8)
  • Length: 173  
  • Mass: 19572
  • Tissue specificity: Highly expressed in liver and pancreas. {ECO
• Sequence:

  MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMF
  VAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAF
  LVTICYAGNTYFSFIAWRSRTIQ

• Structural information:
  • Protein Domains: (36..16-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR013295  IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000307741
• Other Databases: GeneCards:  CMTM8  Malacards:  CMTM8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042552	myelination	IBA	biological process
GO:0019911	structural constituent of myelin sheath	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray