• Gene id: 152185

Gene Summary

• Gene Symbol: SPICE1   Gene   UCSC   Ensembl
• Aliases: CCDC52, SPICE
• Gene name: spindle and centriole associated protein 1
• Alternate names: spindle and centriole-associated protein 1, coiled-coil domain-containing protein 52,
• Gene location: 3q13.2 (113515155: 113442717)     Exons: 19     NC_000003.12
• OMIM: 616537

Protein Summary

• Protein general information: Q8N0Z3  
  • Name: Spindle and centriole associated protein 1 (Coiled coil domain containing protein 52) (Spindle and centriole associated protein)
  • Length: 855  
  • Mass: 96264
• Sequence:

  MSFVRVNRCGPRVGVRKTPKVKKKKTSVKQEWDNTVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKR
  KWRKQKPETLNLEKRRLSIMKEILSDQYQMQDVLEKSDHLIAAAKELFPRRRTGFPNVTVAPDSSQGPIVVNQDP
  ITQSIFNESVIEPQALNDVDGEEEGTVNSQSGESENENELDNSLNSQSNTNTDRFLQQLTEENFELISKLWTDIQ
  QKIATQSQITPPGTPSSALSSGEQRAALNATNAVKRLQTRLQPEESTETLDSSYVVGHVLNSRKQKQLLNKVKRK
  PNLHALSKPKKNISSGSTTSADLPNRTNSNLDVLKHMIHEVEHEMEEYERWTGREVKGLQSSQGLTGFTLSLVSS
  LCRLVRYLKESEIQLRKEVETRQQLEQVLGDHRELIDALTAEILRLREENAATQARLQQYMVTTDEQLISLTHAI
  KNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVPDPPDNMNLAKNF
  PAHIFEPAVLLTPPRQKSNLKFSPLQDVLRRTVQTRPAPRLPPTVEIIEKEQNWEEKTLPIDTDIQNSSEENRLF
  TQRWRVSHMGEDLENKTQAPFVNLSQPLCNSHSNTQQSRSPTFSEELPVLGDGQQLRTNESLIQRKDIMTRIADL
  TLQNSAIKAHMNNIIEPRGEQGDGLRELNKQESASDMTSTFPVAQSLTPGSMEERIAELNRQSMEARGKLLQLIE
  QQKLVGLNLSPPMSPVQLPLRAWTEGAKRTIEVSIPGAEAPESSKCSTVSPVSGINTRRSSGATGNSCSPLNATS
  GSGRFTPLNPRAKIEKQNEEGWFALSTHVS

• Structural information:
  • Interpro: IPR031387  
  • STRING: ENSP00000295872
• Other Databases: GeneCards:  SPICE1  Malacards:  SPICE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0046599	regulation of centriole replication	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0051310	metaphase plate congression	IBA	biological process
GO:0005819	spindle	IBA	cellular component
GO:0005814	centriole	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0090307	mitotic spindle assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0051310	metaphase plate congression	IMP	biological process
GO:0046599	regulation of centriole replication	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray