• Gene id: 152015

Gene Summary

• Gene Symbol: ROPN1B   Gene   UCSC   Ensembl
• Gene name: rhophilin associated tail protein 1B
• Alternate names: ropporin-1B, AKAP-binding sperm protein ropporin, rhophilin-associated protein 1B, ropporin, rhophilin associated protein 1B, testis tissue sperm-binding protein Li 83P,
• Gene location: 3q21.2 (125969160: 125983453)     Exons: 1     NC_000003.12

Protein Summary

• Protein general information: Q9BZX4  
  • Name: Ropporin 1B (Rhophilin associated protein 1B)
  • Length: 212  
  • Mass: 23964
• Sequence:

  MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL
  HSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHN
  GGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

• Structural information:
  • Protein Domains: (12..4-)
    (/note="RIIa"-)
  • STRING: ENSP00000426271
• Other Databases: GeneCards:  ROPN1B  Malacards:  ROPN1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048240	sperm capacitation	IBA	biological process
GO:0031514	motile cilium	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0061512	protein localization to cilium	ISS	biological process
GO:0048240	sperm capacitation	ISS	biological process
GO:0044782	cilium organization	ISS	biological process
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0001932	regulation of protein phosphorylation	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030317	flagellated sperm motility	TAS	biological process
GO:0007340	acrosome reaction	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0007342	fusion of sperm to egg plasma membrane involved in single fertilization	NAS	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0030159	signaling receptor complex adaptor activity	NAS	molecular function
GO:0007283	spermatogenesis	NAS	biological process
GO:0007266	Rho protein signal transduction	TAS	biological process
GO:0061640	cytoskeleton-dependent cytokinesis	NAS	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)