• Gene id: 152007

Gene Summary

• Gene Symbol: GLIPR2   Gene   UCSC   Ensembl
• Aliases: C9orf19, GAPR-1, GAPR1
• Gene name: GLI pathogenesis related 2
• Alternate names: Golgi-associated plant pathogenesis-related protein 1, 17kD fetal brain protein, gliPR 2, glioma pathogenesis-related protein 2, golgi-associated PR-1 protein,
• Gene location: 9p13.3 (36136535: 36163912)     Exons: 8     NC_000009.12
• OMIM: 607141

Protein Summary

• Protein general information: Q9H4G4  
  • Name: Golgi associated plant pathogenesis related protein 1 (GAPR 1) (Golgi associated PR 1 protein) (Glioma pathogenesis related protein 2) (GliPR 2)
  • Length: 154  
  • Mass: 17218
  • Tissue specificity: Highest expression in lung and peripheral leukocytes, and minor expression in liver and kidney. {ECO
• Sequence:

  MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQT
  GKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVL
  PPKK

• Structural information:
  • Protein Domains: (14..13-)
    (/note="SCP"-)
  • Interpro: IPR018244  IPR014044  IPR035940  IPR001283  IPR034113  
  • Prosite: PS01009
  • CDD: cd05382
  • PDB: 1SMB 4AIW 5VHG
  • PDBsum: 1SMB 4AIW 5VHG
  • DIP: 60127
  • STRING: ENSP00000367196
• Other Databases: GeneCards:  GLIPR2  Malacards:  GLIPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0010634	positive regulation of epithelial cell migration	IDA	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray