• Gene id: 152006

Gene Summary

• Gene Symbol: RNF38   Gene   UCSC   Ensembl
• Gene name: ring finger protein 38
• Alternate names: E3 ubiquitin-protein ligase RNF38, RING-type E3 ubiquitin transferase RNF38,
• Gene location: 9p13.2 (36487383: 36336397)     Exons: 19     NC_000009.12
• Gene summary(Entrez): This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, developm
• OMIM: 612488

Protein Summary

• Protein general information: Q9H0F5  
  • Name: E3 ubiquitin protein ligase RNF38 (EC 2.3.2.27) (RING finger protein 38) (RING type E3 ubiquitin transferase RNF38)
  • Length: 515  
  • Mass: 57595
  • Tissue specificity: Widely expressed with highest levels in testis. {ECO
• Sequence:

  MACKISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNTTVQEDAHFKAFFQSEDSPSPKRQRLSHSVFDYTS
  ASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQDENYHHLPYA
  QQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGIPLCTGQHIPACSTQQ
  VPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQ
  SRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGVPYPPFMPRRLTGRSRYRS
  QQPIPPPPYHPSLLPYVLSMLPVPPAVGPTFSFELDVEDGEVENYEALLNLAERLGEAKPRGLTKADIEQLPSYR
  FNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRDSE

• Structural information:
  • Interpro: IPR001841  IPR013083  
  • Prosite: PS50089
  • PDB: 1X4J 4V3K 4V3L
  • PDBsum: 1X4J 4V3K 4V3L
  • STRING: ENSP00000259605
• Other Databases: GeneCards:  RNF38  Malacards:  RNF38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036126	sperm flagellum	IEA	cellular component
GO:0008584	male gonad development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq