• Gene id: 1520

Gene Summary

• Gene Symbol: CTSS   Gene   UCSC   Ensembl
• Gene name: cathepsin S
• Alternate names: cathepsin S,
• Gene location: 1q21.3 (150765777: 150730187)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The preproprotein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that participates in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The mature protein cleaves t
• OMIM: 612046

Protein Summary

• Protein general information: P25774  
  • Name: Cathepsin S (EC 3.4.22.27)
  • Length: 331  
  • Mass: 37496
• Sequence:

  MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDL
  GMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEA
  QLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCS
  KYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
  GHNFGEEGYIRMARNKGNHCGIASFPSYPEI

• Structural information:
  • Interpro: IPR038765  IPR025661  IPR000169  IPR025660  IPR000668   IPR039417  IPR013201  
  • Prosite: PS00640 PS00139 PS00639
  • CDD: cd02248
  • PDB: 1BXF 1GLO 1MS6 1NPZ 1NQC 2C0Y 2F1G 2FQ9 2FRA 2FRQ 2FT2 2FUD 2FYE 2G6D 2G7Y 2H7J 2HH5 2HHN 2HXZ 2OP3 2R9M 2R9N 2R9O 3IEJ 3N3G 3N4C 3OVX 4P6E 4P6G 5QBU 5QBV 5QBW 5QBX 5QBY 5QBZ 5QC0 5QC1 5QC2 5QC3 5QC4 5QC5 5QC6 5QC7 5QC8 5QC9 5QCA 5QCB 5QCC 5QCD 5QCE 5QCF 5QCG 5QCH 5QCI 5QCJ
  • PDBsum: 1BXF 1GLO 1MS6 1NPZ 1NQC 2C0Y 2F1G 2FQ9 2FRA 2FRQ 2FT2 2FUD 2FYE 2G6D 2G7Y 2H7J 2HH5 2HHN 2HXZ 2OP3 2R9M 2R9N 2R9O 3IEJ 3N3G 3N4C 3OVX 4P6E 4P6G 5QBU 5QBV 5QBW 5QBX 5QBY 5QBZ 5QC0 5QC1 5QC2 5QC3 5QC4 5QC5 5QC6 5QC7 5QC8 5QC9 5QCA 5QCB 5QCC 5QCD 5QCE 5QCF 5QCG 5QCH 5QCI 5QCJ
  • DIP: 61077
  • STRING: ENSP00000357981
• Other Databases: GeneCards:  CTSS  Malacards:  CTSS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005770	late endosome	IDA	cellular component
GO:2001259	positive regulation of cation channel activity	IDA	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0010447	response to acidic pH	IDA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0048002	antigen processing and presentation of peptide antigen	IDA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0006955	immune response	IBA	biological process
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0036021	endolysosome lumen	TAS	cellular component
GO:0036021	endolysosome lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0005518	collagen binding	IDA	molecular function
GO:0043236	laminin binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0034769	basement membrane disassembly	IDA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0001968	fibronectin binding	IPI	molecular function
GO:0043394	proteoglycan binding	IPI	molecular function
GO:0030574	collagen catabolic process	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0097067	cellular response to thyroid hormone stimulus	IEP	biological process
GO:0002250	adaptive immune response	IEP	biological process
GO:0019882	antigen processing and presentation	TAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:2001259	positive regulation of cation channel activity	IDA	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0010447	response to acidic pH	IDA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0048002	antigen processing and presentation of peptide antigen	IDA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0006955	immune response	IBA	biological process
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0036021	endolysosome lumen	TAS	cellular component
GO:0036021	endolysosome lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0005518	collagen binding	IDA	molecular function
GO:0043236	laminin binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0034769	basement membrane disassembly	IDA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0001968	fibronectin binding	IPI	molecular function
GO:0043394	proteoglycan binding	IPI	molecular function
GO:0030574	collagen catabolic process	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0097067	cellular response to thyroid hormone stimulus	IEP	biological process
GO:0002250	adaptive immune response	IEP	biological process
GO:0019882	antigen processing and presentation	TAS	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04142	Lysosome
hsa04210	Apoptosis
hsa04612	Antigen processing and presentation

Diseases

Associated diseases	References
Alzheimer's disease	PMID:7717452
Intracranial aneurysm	PMID:18635848
Down syndrome	PMID:7717452
Multiple sclerosis	PMID:21143385
Carotid artery disease	PMID:9691094
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R