• Gene id: 152

Gene Summary

• Gene Symbol: ADRA2C   Gene   UCSC   Ensembl
• Aliases: ADRA2L2, ADRA2RL2, ADRARL2, ALPHA2CAR
• Gene name: adrenoceptor alpha 2C
• Alternate names: alpha-2C adrenergic receptor, adrenergic, alpha-2C-, receptor, alpha-2 adrenergic receptor subtype C4, alpha-2C adrenoceptor, alpha-2C adrenoreceptor, alpha-2CAR, alpha2-AR-C4,
• Gene location: 4p16.3 (3766384: 3768525)     Exons: 1     NC_000004.12
• Gene summary(Entrez): Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic
• OMIM: 123857

Protein Summary

• Protein general information: P18825  
  • Name: Alpha 2C adrenergic receptor (Alpha 2 adrenergic receptor subtype C4) (Alpha 2C adrenoreceptor) (Alpha 2C adrenoceptor) (Alpha 2CAR)
  • Length: 462  
  • Mass: 49522
• Sequence:

  MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGFLIVFTVVGNVLVVIA
  VLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRY
  WSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLI
  MGLVYARIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
  LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQA
  REKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFKH
  ILFRRRRRGFRQ

• Structural information:
  • Interpro: IPR002233  IPR000735  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000386069
• Other Databases: GeneCards:  ADRA2C  Malacards:  ADRA2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0051379	epinephrine binding	IBA	molecular function
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004938	alpha2-adrenergic receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0070473	negative regulation of uterine smooth muscle contraction	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0007565	female pregnancy	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051379	epinephrine binding	IDA	molecular function
GO:0031694	alpha-2A adrenergic receptor binding	IPI	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0045666	positive regulation of neuron differentiation	IDA	biological process
GO:0035624	receptor transactivation	IDA	biological process
GO:0010700	negative regulation of norepinephrine secretion	NAS	biological process
GO:0010700	negative regulation of norepinephrine secretion	TAS	biological process
GO:0071875	adrenergic receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0032811	negative regulation of epinephrine secretion	NAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04022	cGMP-PKG signaling pathway

Diseases

Associated diseases	References
congestive heart failure	PMID:12374873
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881