• Gene id: 151987

Gene Summary

• Gene Symbol: PPP4R2   Gene   UCSC   Ensembl
• Aliases: PP4R2
• Gene name: protein phosphatase 4 regulatory subunit 2
• Alternate names: serine/threonine-protein phosphatase 4 regulatory subunit 2,
• Gene location: 3p13 (72996742: 73069200)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a regulatory subunit of the serine/threonine-protein phosphatase 4 complex. In addition to being required for efficient DNA double strand break repair, this complex plays a role in organization of microtubules at centro
• OMIM: 613822

Protein Summary

• Protein general information: Q9NY27  
  • Name: Serine/threonine protein phosphatase 4 regulatory subunit 2
  • Length: 417  
  • Mass: 46898
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MDVERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGPPNPNV
  EYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVYPSSEKNNSNSLNRM
  NGVMFPGNSPSYTERSNINGPGTPRPLNRPKVSLSAPMTTNGLPESTDSKEANLQQNEEKNHSDSSTSESEVSSV
  SPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQHCTEED
  EEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNEETSEENNQMEESDVSQAEKDLLHSEGSENEGPVSSSSS
  DCRETEELVGSNSSKTGEILSESSMENDDEATEVTDEPMEQD

• Structural information:
  • Interpro: IPR015267  
  • STRING: ENSP00000349124
• Other Databases: GeneCards:  PPP4R2  Malacards:  PPP4R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030289	protein phosphatase 4 complex	IBA	cellular component
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0019888	protein phosphatase regulator activity	IMP	molecular function
GO:0030289	protein phosphatase 4 complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	TAS	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0030289	protein phosphatase 4 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0010569	regulation of double-strand break repair via homologous recombination	IMP	biological process
GO:0030674	protein-macromolecule adaptor activity	IMP	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq