• Gene id: 151742

Gene Summary

• Gene Symbol: PPM1L   Gene   UCSC   Ensembl
• Aliases: PP2C-epsilon, PP2CE, PPM1-LIKE
• Gene name: protein phosphatase, Mg2+/Mn2+ dependent 1L
• Alternate names: protein phosphatase 1L, PP2C epsilon, Protein phosphatase 2C epsilon isoform, protein phosphatase 2C isoform epsilon,
• Gene location: 3q25.33-q26.1 (35673808: 35681158)     Exons: 11     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a magnesium or manganese-requiring phosphatase that is involved in several signaling pathways. The encoded protein downregulates apoptosis signal-regulating kinase 1, a protein that initiates a signaling cascade that le
• OMIM: 611931

Protein Summary

• Protein general information: Q5SGD2  
  • Name: Protein phosphatase 1L (EC 3.1.3.16) (Protein phosphatase 1 like) (Protein phosphatase 2C isoform epsilon) (PP2C epsilon)
  • Length: 360  
  • Mass: 41053
  • Tissue specificity: Ubiquitous. Highly expressed in heart, placenta, lung, liver, kidney and pancreas. {ECO
• Sequence:

  MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGL
  DVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQH
  LQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAI
  PLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA
  SDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

• Structural information:
  • Protein Domains: (92..35-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR036457  IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • STRING: ENSP00000417659
• Other Databases: GeneCards:  PPM1L  Malacards:  PPM1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0000165	MAPK cascade	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)