• Gene id: 151648

Gene Summary

• Gene Symbol: SGO1   Gene   UCSC   Ensembl
• Aliases: CAID, NY-BR-85, SGO, SGOL1
• Gene name: shugoshin 1
• Alternate names: shugoshin 1, serologically defined breast cancer antigen NY-BR-85, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein,
• Gene location: 3p24.3 (20188142: 20160592)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this g
• OMIM: 609168

Protein Summary

• Protein general information: Q5FBB7  
  • Name: Shugoshin 1 (Serologically defined breast cancer antigen NY BR 85) (Shugoshin like 1)
  • Length: 561  
  • Mass: 64190
  • Tissue specificity: Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested. {ECO
• Sequence:

  MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKV
  KEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPG
  QGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFER
  VGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
  RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREENNESEVSLCESSGSG
  DDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDITNVSLY
  PVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALE
  VSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR

• Structural information:
  • Interpro: IPR028321  IPR038889  IPR011515  IPR011516  
  • PDB: 3FGA 3Q6S 4A0I
  • PDBsum: 3FGA 3Q6S 4A0I
  • DIP: 36614
  • STRING: ENSP00000263753
• Other Databases: GeneCards:  SGO1  Malacards:  SGO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0000776	kinetochore	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0000780	condensed nuclear chromosome, centromeric region	IBA	cellular component
GO:0045143	homologous chromosome segregation	IBA	biological process
GO:0051177	meiotic sister chromatid cohesion	IBA	biological process
GO:0010457	centriole-centriole cohesion	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	colocalizes with
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	colocalizes with
GO:0000776	kinetochore	IDA	cellular component
GO:0008608	attachment of spindle microtubules to kinetochore	IDA	biological process
GO:0007059	chromosome segregation	IDA	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045132	meiotic chromosome segregation	IEA	biological process
GO:0071962	mitotic sister chromatid cohesion, centromeric	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007059	chromosome segregation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0019900	kinase binding	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0045132	meiotic chromosome segregation	IMP	biological process
GO:0010457	centriole-centriole cohesion	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000779	condensed chromosome, centromeric region	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0071962	mitotic sister chromatid cohesion, centromeric	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04114	Oocyte meiosis

Diseases

Associated diseases	References
Chronic atrial and intestinal dysrhythmia	KEGG:H02122
Chronic atrial and intestinal dysrhythmia	KEGG:H02122
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq