• Gene id: 151647

Gene Summary

• Gene Symbol: TAFA4   Gene   UCSC   Ensembl
• Aliases: FAM19A4, TAFA-4
• Gene name: TAFA chemokine like family member 4
• Alternate names: chemokine-like protein TAFA-4, family with sequence similarity 19 (chemokine (C-C motif)-like), member A4, family with sequence similarity 19 member A4, C-C motif chemokine like, protein FAM19A4,
• Gene location: 3p14.1 (31897697: 31879758)     Exons: 29     NC_000006.12
• Gene summary(Entrez): This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
• OMIM: 617498

Protein Summary

• Protein general information: Q96LR4  
  • Name: Chemokine like protein TAFA 4
  • Length: 140  
  • Mass: 15682
  • Tissue specificity: Expressed in brain (PubMed
• Sequence:

  MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVK
  CSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR

• Structural information:
  • Interpro: IPR020350  
  • STRING: ENSP00000295569
• Other Databases: GeneCards:  TAFA4  Malacards:  TAFA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048246	macrophage chemotaxis	IBA	biological process
GO:0006909	phagocytosis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0048018	receptor ligand activity	IBA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0048246	macrophage chemotaxis	ISS	biological process
GO:0042554	superoxide anion generation	ISS	biological process
GO:0010469	regulation of signaling receptor activity	ISS	biological process
GO:0006909	phagocytosis	ISS	biological process
GO:0048018	receptor ligand activity	ISS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0010469	regulation of signaling receptor activity	IEA	biological process
GO:0042554	superoxide anion generation	IEA	biological process
GO:0048246	macrophage chemotaxis	IEA	biological process
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0048018	receptor ligand activity	IEA	molecular function
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881