• Gene id: 151306

Gene Summary

• Gene Symbol: GPBAR1   Gene   UCSC   Ensembl
• Aliases: BG37, GPCR19, GPR131, M-BAR, TGR5
• Gene name: G protein-coupled bile acid receptor 1
• Alternate names: G-protein coupled bile acid receptor 1, G-protein coupled bile acid receptor BG37, G-protein coupled receptor GPCR19, membrane bile acid receptor, membrane-type receptor for bile acids,
• Gene location: 2q35 (218259495: 218263860)     Exons: 3     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activat

Protein Summary

• Protein general information: Q8TDU6  
  • Name: G protein coupled bile acid receptor 1 (G protein coupled receptor GPCR19) (hGPCR19) (Membrane type receptor for bile acids) (M BAR) (hBG37) (BG37)
  • Length: 330  
  • Mass: 35248
  • Tissue specificity: Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse col
• Sequence:

  MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLW
  NQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWT
  PGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARA
  QAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
  GLWGRASRDSPGPSIAYHPSSQSSVDLDLN

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000430886
• Other Databases: GeneCards:  GPBAR1  Malacards:  GPBAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:1904056	positive regulation of cholangiocyte proliferation	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:2000810	regulation of bicellular tight junction assembly	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0038184	cell surface bile acid receptor signaling pathway	IDA	biological process
GO:0038182	G protein-coupled bile acid receptor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:1903413	cellular response to bile acid	IDA	biological process
GO:1903413	cellular response to bile acid	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0038184	cell surface bile acid receptor signaling pathway	IDA	biological process
GO:0038181	bile acid receptor activity	IDA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0038182	G protein-coupled bile acid receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Polycystic kidney disease	PMID:28543567
autosomal dominant polycystic kidney disease	PMID:28543567
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq