About Us

Search Result


Gene id 151242
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol PPP1R1C   Gene   UCSC   Ensembl
Aliases IPP5
Gene name protein phosphatase 1 regulatory inhibitor subunit 1C
Alternate names protein phosphatase 1 regulatory subunit 1C, PP1 inhibitor protein 5, inhibitor-5 of protein phosphatase 1, protein phosphatase 1 regulatory subunit 1A,
Gene location 2q31.3-q32.1 (181954240: 182131384)     Exons: 9     NC_000002.12
Gene summary(Entrez) Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or
OMIM 613240

Protein Summary

Protein general information Q8WVI7  

Name: Protein phosphatase 1 regulatory subunit 1C (Inhibitor 5 of protein phosphatase 1) (IPP5)

Length: 109  Mass: 12346

Sequence MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYT
PPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Structural information
Interpro:  IPR008466  
STRING:   ENSP00000280295
Other Databases GeneCards:  PPP1R1C  Malacards:  PPP1R1C

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0035556 intracellular signal tran
sduction
IBA biological process
GO:0005737 cytoplasm
IBA cellular component
GO:0004864 protein phosphatase inhib
itor activity
IEA molecular function
GO:0007165 signal transduction
IEA biological process
GO:0004864 protein phosphatase inhib
itor activity
IEA molecular function
GO:0051301 cell division
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0007049 cell cycle
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0032515 negative regulation of ph
osphoprotein phosphatase
activity
IEA biological process
GO:0032515 negative regulation of ph
osphoprotein phosphatase
activity
IEA biological process
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract