• Gene id: 151195

Gene Summary

• Gene Symbol: CCNYL1   Gene   UCSC   Ensembl
• Gene name: cyclin Y like 1
• Alternate names: cyclin-Y-like protein 1,
• Gene location: 2q33.3 (207711539: 207756173)     Exons: 11     NC_000002.12

Protein Summary

• Protein general information: Q8N7R7  
  • Name: Cyclin Y like protein 1
  • Length: 359  
  • Mass: 40705
• Sequence:

  MGNTLTCCVSPNASPKLGRRAGSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEGHHLQHISDREMPEDL
  ALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHVSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIY
  YHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEI
  DICPTNWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPASVYAKYYFDLRS
  LADDNNLNFLFAPLSKERAQNLEAISRLCEDKDLCRAAMRRSFSADNFIGIQRSKAILS

• Structural information:
  • Protein Domains: (145..26-)
    (/note="Cyclin-N-terminal")
  • Interpro: IPR013763  IPR036915  IPR006671  IPR012399  
  • CDD: cd00043
• Other Databases: GeneCards:  CCNYL1  Malacards:  CCNYL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881