• Gene id: 151194

Gene Summary

• Gene Symbol: METTL21A   Gene   UCSC   Ensembl
• Aliases: FAM119A, HCA557b, HSPA-KMT
• Gene name: methyltransferase like 21A
• Alternate names: protein N-lysine methyltransferase METTL21A, HSPA lysine methyltransferase, family with sequence similarity 119, member A, heat shock protein 70kDa lysine (K) methyltransferase, hepatocellular carcinoma-associated antigen 557b, methyltransferase-like protein 2,
• Gene location: 2q33.3 (26200774: 26189919)     Exons: 14     NC_000007.14
• OMIM: 615257

Protein Summary

• Protein general information: Q8WXB1  
  • Name: Protein N lysine methyltransferase METTL21A (EC 2.1.1. ) (HSPA lysine methyltransferase) (HSPA KMT) (Hepatocellular carcinoma associated antigen 557b) (Methyltransferase like protein 21A)
  • Length: 218  
  • Mass: 24600
• Sequence:

  MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAG
  TGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEE
  TFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQKRNQKEDL

• Structural information:
  • Interpro: IPR019410  IPR029063  
  • PDB: 4LEC
  • PDBsum: 4LEC
  • STRING: ENSP00000415115
• Other Databases: GeneCards:  METTL21A  Malacards:  METTL21A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016279	protein-lysine N-methyltransferase activity	IDA	molecular function
GO:0032259	methylation	IBA	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0018022	peptidyl-lysine methylation	IBA	biological process
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0016279	protein-lysine N-methyltransferase activity	IDA	molecular function
GO:0006479	protein methylation	IDA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0016279	protein-lysine N-methyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016279	protein-lysine N-methyltransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0043462	regulation of ATPase activity	IDA	NOT|biological process
GO:0018022	peptidyl-lysine methylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008276	protein methyltransferase activity	IDA	molecular function
GO:0006479	protein methylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881