• Gene id: 151126

Gene Summary

• Gene Symbol: ZNF385B   Gene   UCSC   Ensembl
• Aliases: ZNF533
• Gene name: zinc finger protein 385B
• Alternate names: zinc finger protein 385B, zinc finger protein 533,
• Gene location: 2q31.2-q31.3 (57079307: 56727418)     Exons: 21     NC_000003.12
• OMIM: 612344

Protein Summary

• Protein general information: Q569K4  
  • Name: Zinc finger protein 385B (Zinc finger protein 533)
  • Length: 471  
  • Mass: 50407
  • Tissue specificity: Detected in germinal center of lymph node (at protein level). Expressed in spleen, lymph node and tonsil. {ECO
• Sequence:

  MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRKRVKQLSDGQPPPPAQ
  ASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDSSSAVGLFPNFNTMDPVQKAVINHTFGVSIP
  PKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSED
  KGKLKASSSSQPSSSESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAKKLLYCSLCKVAVNSLSQL
  EAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSEIQLKQHISSRRHKDR
  VAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSPLAAAAAVSSALSLPPRPSASLFQAPAIPPA
  LLRPGHGPIRATPASILFAPY

• Structural information:
  • Interpro: IPR003604  IPR036236  IPR013087  
  • STRING: ENSP00000386845
• Other Databases: GeneCards:  ZNF385B  Malacards:  ZNF385B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0002039	p53 binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)