• Gene id: 1511

Gene Summary

• Gene Symbol: CTSG   Gene   UCSC   Ensembl
• Aliases: CATG, CG
• Gene name: cathepsin G
• Alternate names: cathepsin G,
• Gene location: 14q12 (24576249: 24573517)     Exons: 5     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in th
• OMIM: 116830

Protein Summary

• Protein general information: P08311  
  • Name: Cathepsin G (CG) (EC 3.4.21.20)
  • Length: 255  
  • Mass: 28837
• Sequence:

  MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLG
  AHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRV
  SMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPP
  EVFTRVSSFLPWIRTTMRSFKLLDQMETPL

• Structural information:
  • Protein Domains: (21..24-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1AU8 1CGH 1KYN 1T32
  • PDBsum: 1AU8 1CGH 1KYN 1T32
  • STRING: ENSP00000216336
• Other Databases: GeneCards:  CTSG  Malacards:  CTSG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0006955	immune response	TAS	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0008233	peptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0002003	angiotensin maturation	TAS	biological process
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050832	defense response to fungus	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0070946	neutrophil-mediated killing of gram-positive bacterium	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0008236	serine-type peptidase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04142	Lysosome
hsa05322	Systemic lupus erythematosus
hsa05146	Amoebiasis
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray